CAZyme Information: MGYG000001516_00401

Basic Information

• Species: Limosilactobacillus antri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus antri
• CAZyme ID: MGYG000001516_00401
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809	MGYG000001516_5|CGC1	88934.11	5.8378

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001516	2241837	Isolate	not provided	not provided

• Gene Location: Start: 41135; End: 43564 Strand: -

Full Sequence      

MDFKSVRSKILPTVTVCGAALFLLGAQPVLADQAPAGQNGSVTVNTAMAGNQTSSTAQNA
SAYNHDDHGNYAWLDHVALDNKGQLNVAGWHATNEAVNRPYHYLIALNQDRQEIARENIS
GQNIARPDVQAVHNVYNAGQSGFVGRLDLSGALKDTDSITLISRYTSDAGGNFNYIDYWF
APVTVDQTNRGSLDNASVKDNQLELAGWNATNRAAGRPYHYVILIDRTTGREIGRQLVTA
GMERPDVARVFPEVAGAGQAGFAVHFNLTGIDFNHQLQVLSRYAGDPAGNANYVDFYYQP
LTTGNYANQGWLDGFNLSDGKHLEVSGWHANDVSRFENQHFIILFDNTANQQVAVMRVTN
SDRPDVQRVYQNIATAGHSGFNADLALTADQLCAGHMYSIVSRYSTSSDGNGGTGQYTDM
WFKAFTLNQQNYCLDSIKMQQDGLQVAGWMTSDYSLNRPYAFVIVLADGREIARKAVTLT
PRPDVAKANPTVFNSLTSGFETTVNFNPAAVTGKLQVILRFTNDPVGNGDASDQYSSSYA
SNDGWFDQINVSDKGIYVSGWHASDQSANKPYQYLIFIDTRTGQELYRQRILDVNRERGD
LANQRPYILNSDHSGYQLGFNLPASLDHHTVRIIHRFTDDINGNGNYVDLTSDPVKIHDD
RWAWPFPAIGRGSFTSGQLFGVHPGNDRINSFHDGLDFGAYDHPGSTVQAIHSGTIVKIG
YAKGLENYVVEDTGEYLIIYQEAFQSLNNVAVHVGQKINVGDPIGIRNTTHVHIGITRQH
NFWLAEGSAYSNDGTWLDPLVIISNGLNG

Enzyme Prediction     

No EC number prediction in MGYG000001516_00401.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01551	Peptidase_M23	9.21e-12	691	779	1	90	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
cd12797	M23_peptidase	1.07e-11	693	776	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
COG0739	NlpD	1.20e-07	633	776	105	248	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
COG4942	EnvC	2.48e-04	704	765	330	388	Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIZ04740.1	9.03e-153	37	657	93	725
QLL76139.1	2.58e-152	37	657	93	722
AAU08014.2	7.25e-152	37	657	93	725
QDK48457.1	2.70e-151	37	657	93	725
ASA47905.1	3.11e-146	63	657	152	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GT1_A	3.38e-57	660	807	23	171	ChainA, Choline binding protein A [Ligilactobacillus salivarius str. Ren]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999094	0.000174	0.000170	0.000149	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001516_00401.