CAZyme Information: MGYG000001516_00576

Basic Information

• Species: Limosilactobacillus antri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus antri
• CAZyme ID: MGYG000001516_00576
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000001516_10|CGC1	35880.04	8.7948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001516	2241837	Isolate	not provided	not provided

• Gene Location: Start: 922; End: 1851 Strand: -

Full Sequence      

MKYASLIVTYNRKDKLIGALRCLLGQTRKPQKIFLIDNCSTDGTPELLKREGILDNPLVD
YQRMDKNYGGSGGFYHGIKYAMGFAKEFEYLSLSDDDAFFNQDYFEQIEKAAEECPDCRA
FCGTVRYEDGTIQTDHRRRISNPRWLKETEVPESEYRHNFVLDTFSFVGCVISVDILSKI
GLPNKEYFIYYDDTEYSLRVRSLTNIINVSSAVVVHQTPKKSNGLVEINWKTYYGFRNAI
LMKKQHSDWKWLNLYFIWHQLKLNVELLSSPVFKGKRRPAMRVYNRAFKDGMAGIEGKQA
PFLPGNKID

Enzyme Prediction     

No EC number prediction in MGYG000001516_00576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	173	2.4e-20	0.9294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	1.27e-66	6	242	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.86e-37	6	299	8	291	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	1.20e-23	5	242	1	236	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	1.34e-19	6	150	3	141	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	3.38e-19	7	216	3	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGR65329.1	3.60e-120	1	304	1	304
QQR14342.1	1.68e-118	1	304	1	304
ANU51696.1	1.68e-118	1	304	1	304
ANK70436.1	4.13e-95	1	304	1	306
ANK62553.1	4.13e-95	1	304	1	306

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001516_00576.