CAZyme Information: MGYG000001516_02049

Basic Information

• Species: Limosilactobacillus antri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus antri
• CAZyme ID: MGYG000001516_02049
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		40669.3	9.1359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001516	2241837	Isolate	not provided	not provided

• Gene Location: Start: 29911; End: 31035 Strand: +

Full Sequence      

MKKQILTAIIAGMLLAANGSPVLAAGVDLNGAYRDAEQAIVNQQPLDEGQIRQRGEEYTS
AFLTAFSQLSQDYEQSFRQGVSDGLKGSLSQQTRSRVGQAGYQRGYRRGQQLRPQPQPGQ
PDPPATAPANPPVPAVPAEQAPAQPVSGPDQQEYPAQEPSPDQAKFISRVAKSAQKVGME
YDLYPSVIIAQAALESNWGSSELARKPYHNLFGVKGSFNGKSVLQPTTEYTHDGHEQKIN
DHFRWYENDYQSLCDYAETLADPLYAGVHRGQAGNYRSATHALLGRYATDPQYDRKLNKI
IASYGLTKYDADLPAGKASRGDQKSQTQQPVATVRGQQATGPHKPTHHLTWLSIVGGAGS
AGALGLLRRFLIKA

Enzyme Prediction     

No EC number prediction in MGYG000001516_02049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	171	306	1.2e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.59e-50	162	311	42	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	8.98e-42	160	330	317	498	amidase domain-containing protein.
PRK06347	PRK06347	6.67e-37	139	327	112	316	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	2.30e-30	164	310	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	3.53e-26	139	313	126	312	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZN92542.1	2.00e-108	1	372	1	362
QFV01117.1	2.74e-73	1	373	3	382
QFG72894.1	7.46e-73	150	373	2	223
CUU12250.1	4.45e-64	150	373	110	337
AGN98886.1	4.45e-64	150	373	110	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.06e-37	163	310	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.96e-30	160	310	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.51e-15	162	301	2	145	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.11e-15	162	301	2	145	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.02e-14	169	306	11	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CIT4	1.23e-34	166	321	65	225	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	3.17e-34	166	319	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	3.06e-33	166	319	65	223	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P37710	6.72e-32	152	321	169	344	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	1.02e-31	164	310	63	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.998901	0.000205	0.000208	0.000187	0.000166

TMHMM  Annotations     

start	end
5	27