CAZyme Information: MGYG000001517_00579

Basic Information

• Species: Lactobacillus amylolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus amylolyticus
• CAZyme ID: MGYG000001517_00579
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	MGYG000001517_12|CGC1	25081.16	10.547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001517	1537388	Isolate	not provided	not provided

• Gene Location: Start: 15525; End: 16175 Strand: +

Full Sequence      

MAKKRKKHRISKSMGIILRTFLILVVLLVAFICFRYYRRQALQSQQIRQEQVQKQQEQAK
LLRQRKAFIKKIGPIAKEVDKSYDLLPSITIAQACLESNYGQSDLSQKYNNLFGIKGTNP
NTSVVLVTKEYVKGKWVNVKARFQIYDSCEASIRAHARLFQNGTTWNHKQYKHVLAAKNY
KQQAKELVTDGYATDPNYAAKLVSLIEQYNLQKYDK

Enzyme Prediction     

No EC number prediction in MGYG000001517_00579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	73	211	4.7e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.21e-63	67	216	45	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.38e-35	64	216	319	473	amidase domain-containing protein.
smart00047	LYZ2	3.03e-35	66	215	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	2.93e-28	65	215	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK06347	PRK06347	1.75e-26	66	215	151	303	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFY04395.1	6.09e-144	1	216	1	216
ARD07095.1	1.01e-142	1	216	1	216
QQP28148.1	1.06e-114	1	216	1	215
QFQ68512.1	1.01e-112	1	216	1	215
QNT43793.1	1.01e-112	1	216	1	215

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	9.42e-29	65	215	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.04e-20	68	215	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.92e-14	66	208	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.60e-14	66	208	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.28e-11	67	206	3	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.99e-40	64	216	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	4.68e-27	67	215	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	2.21e-25	67	215	64	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.21e-25	68	215	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	6.01e-22	67	215	64	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999875	0.000030	0.000002	0.000000	0.000000	0.000112

TMHMM  Annotations     

start	end
15	37