CAZyme Information: MGYG000001518_00596

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_00596
• CAZy Family: CE2
• CAZyme Description: Acetylxylan esterase / glucomannan deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001518_4|CGC1	41487.57	5.0566

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 186706; End: 187830 Strand: +

Full Sequence      

MTTNANTKVYALSEIENVKVHGRTTENRSPLTLFWTGSGIELNARGSELWIEVEADYDTY
EPWISIVINSAPVSRQMVTAGRHWICLFRGTNAEAVKNVRVTKDVQAMSGDPGCRLQIHA
VKSDGDLLPVEDKPYKIEFIGDSITSGEGAIGAKAEVDWVPMWFSAIHNYAALTGEALDA
EVRILSQSGWGVLTSWDNNPHSNLPDYYEKVCGLLTGERNKALGAWNDNDFASWQPDVVV
VNLGTNDGGAFHSPEWKDEATGETHKQRLNEDGTFHDEDLRAFEEAVVKFLGKLRTFNPK
AQIVWVYGMLGLPMMPAIYRAVDAYKSKTGDRKVSVFQLPNTTEETVGSRTHPGALAHER
AAKELTGYLREILS

Enzyme Prediction     

No EC number prediction in MGYG000001518_00596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	136	368	2.8e-63	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	2.18e-30	136	370	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
cd00229	SGNH_hydrolase	4.43e-07	137	365	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	7.28e-07	139	325	1	125	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam00657	Lipase_GDSL	1.77e-04	137	365	1	224	GDSL-like Lipase/Acylhydrolase.
cd01827	sialate_O-acetylesterase_like1	8.55e-04	136	307	2	115	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV34476.1	5.54e-215	1	374	1	374
AIQ75168.1	4.54e-214	1	374	1	374
QOS81840.1	9.55e-213	1	373	1	373
QZN77000.1	1.36e-212	1	373	1	373
APO43020.1	5.51e-212	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	1.33e-123	16	373	47	404	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	4.32e-122	16	373	47	404	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	1.34e-20	35	373	29	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	3.39e-20	35	373	29	331	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAA_A	6.74e-20	17	373	19	337	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	3.60e-19	35	373	510	812	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	4.16e-19	17	373	38	356	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000024	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_00596.