CAZyme Information: MGYG000001518_00770

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_00770
• CAZy Family: CBM54
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1626	MGYG000001518_4|CGC4	175162.8	4.6144

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 392616; End: 397496 Strand: +

Full Sequence      

MHKRITHLLLAFLLLVPPLLPVTAAADAAAVPGSGNHYASEAMAKWQRAGLLKGYSDGSL
RPDQALTRAEFAVLLQRLFGYPGNEELPYSDVPAAAWYASDLKGLHAAGLMEGYSDGTFK
PNQVVSRQEAIVVLNKAYQFDSGLAATEPATSYSDDAAIAPYAKAAVQEFVRLGFIQGSA
GKFLPNDGLTRGQLAVILDRIVGRWVTSSSPAVGSANNSVIVNAEDALLRNLVIQGNLYL
APGIGEGRVHLDGVKVKGKTYINGGGEPGLVLKDSALAEMVIRRQGGSARIALEGTSSIE
ALTVESDAVLESKASAGKGFGKVTLAANVNVRLIGSFGQVLVGDGAVVTVEGSVENLTVI
GDSATINGVKRGKGYTTVIGGSTAPSSTPGSTGTPTATPTATPTATPTETPTVTPTATPT
ATPTETPTATPTATPTIAPTATPTVTPTVTPTATPTTSPAADWKLVWNDEFDGAEVDLTK
WGYQEGTGAQYGLTDWGNNEQQYYRRDNAQVKDGKLIITAINDGYQGKPYTSARLYTGNT
FTQTYGRFEARMKLPAGQGFWPAFWMMPKDNVYGEWATSGELDILEARGQNPQEVQGTIH
YGQVWPNNKSATGSYTFPEGESFTGYHTYAVEWEPNAIRWYVDDQLYSTQTNWNSKGDGQ
PAKYAHPAPFDQPFYLILNLAVGGNYVSNLVPGPELFPNQMEVDYVRVYQPKNGAYPAPV
EPAIPVGELPENAKLPTTDGNYLYDAEYEQGFNKVTSMPTPLETYDVTDPARWNLVAMTE
FGGNATAEKVLLDGKAFAKVSIAQPGNQSYAIQLIQNFTAVKGRYYKLTFDAKSSATRSL
TFKVGGGPSRGYTTYYSGSAALKDEIQSYEYMFQMEPDTDRLARLELSMGLNANPVWIGN
VRIQEIEPVDPYKENAMKTPLKDGNLLYNGSFDLGRIDRMTYWTFTKAVEGAAASVNPTH
RQLEVTLPEESVQQSDAILSEAGLKLTAKGEYQLSFQAKASAPRTIRVQLTEPSGSAIYA
DSEVALTEAMTEQTVELTLPQAVASEGVFRFLLGGTPGTVTIDSVKLIHVAKPAEWVELA
PSQIVNGTFDQDLTGWNVYNHASSGNSGSADFAVESGIADATVTDLGQDWWNIQFYQDID
AVPAGTYRVRFDLSATVDRSIRVELQGRNGTDSLPQQSYEITPERKTFEWQVQVPAGDYR
LIFGYGKANSDASLPVPHQLHLDNVSFAPVGASLLADGSFANTTAFGASEDDPLPWKLHN
QGQYEEWAGLADVRVEDGIMQADVKQVGWDYWQIQLYQTGLLMTKGFYVIQFDAKATIDR
PLYAELVGGASGKQTVEVGTEWKTYRTYAEVSSDGTYKFMLGLGRIPAEDSRIDAHTVWI
DNVRLAQVPSLPSSLKAAPKLTSGPEHPIVGTNVEIGYDGDEAWRSAVTGVSVNGTVTES
VYFDGGMLVVKGDNFPVSGTYQIKVMAEGYKDALLKQPIWDADGNLVLNGSLTSDSGDWK
HWEGDGGAAAVSYEASGAKIDISATGPQNWSIQFHQEGIPIIAGKTYQVSFKASSTLARS
IMAEYEVGKGLGSFSLTSQEGVYTATFTATSSTAKLNFLIGNVTGTPNSPHTLYIRDVVI
REVTAP

Enzyme Prediction     

No EC number prediction in MGYG000001518_00770.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	467	709	1.6e-86	0.9956521739130435
CBM54	197	308	2.6e-26	0.9824561403508771
CBM4	1485	1600	1.1e-23	0.9841269841269841
CBM4	742	890	4.3e-23	0.9841269841269841
CBM4	1083	1196	1.4e-22	0.8809523809523809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.84e-103	467	709	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd08024	GH16_CCF	1.08e-53	465	710	1	330	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02182	GH16_Strep_laminarinase_like	1.57e-43	463	710	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd00413	Glyco_hydrolase_16	1.91e-42	469	709	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	3.05e-38	462	740	40	292	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG54513.1	2.23e-279	36	1623	109	1528
QJC50501.1	2.62e-275	34	1623	124	1588
QCT01556.1	3.65e-275	36	1404	72	1376
ASS68012.2	7.49e-255	9	1623	10	1569
ABJ15796.1	9.09e-252	38	1623	73	1559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ILN_A	1.26e-58	463	710	5	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
2HYK_A	8.28e-53	465	710	9	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
4DFS_A	1.21e-50	462	713	17	266	Structureof the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],4DFS_B Structure of the catalytic domain of an endo-1,3-beta-glucanase (laminarinase) from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
4CRQ_A	9.45e-50	462	710	2	231	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
2VY0_A	9.53e-50	463	709	13	259	TheX-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	2.93e-63	461	710	421	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
P45798	8.05e-58	460	710	37	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	1.34e-49	463	707	20	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q27082	1.37e-43	463	717	25	260	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q8N0N3	5.38e-30	529	684	130	302	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999057	0.000172	0.000179	0.000158	0.000142

TMHMM  Annotations     

start	end
7	29