CAZyme Information: MGYG000001518_02057

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_02057
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001518_6|CGC6	42977.17	5.718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 548347; End: 549489 Strand: +

Full Sequence      

MVRNGVDCLTAYDPLFKGKRLGLITSPTGRTTDFVSTIELLNERYHLTALFSPEHGVRGD
QEAGGMVETYTDEITGVPVYSLYRKDSKRMTTEMLEQVDAVVYDIQDVGVRYYTFIYTML
YALEDCAKAGKAFIVLDRLNPLGGTAVEGNLLKDDYRSFVGNYPLCIRYGLTVGEFAMMA
NEQMGLKADLHIARCEGWERDMLFPDTGRLWLHPSIGLPRFETALLYAGTCLFEGTNLSE
GRGTTFPFEMIGAPFLDAERLTVEMNRFKLPGVYFRPAYFKPSFSKHQGAACKGVQLHVT
NARSIRPVETGIRLLDVIRRQNEEFSFLSPIREGARPFIDLLGGDRLLRDETLSADSILE
QFRAESEAFAEKKKAYHLYY

Enzyme Prediction     

No EC number prediction in MGYG000001518_02057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	22	379	1.2e-126	0.9943661971830986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	0.0	22	379	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	5.40e-143	2	379	26	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ72626.1	9.51e-207	1	379	1	380
QAY66998.1	2.23e-205	1	379	1	379
QJD87778.1	6.37e-205	2	379	3	381
QMV43642.1	5.22e-204	2	379	3	381
QHW34870.1	6.56e-202	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.53e-73	2	379	13	398	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	2.99e-53	5	379	9	368	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.22e-108	2	379	37	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_02057.