CAZyme Information: MGYG000001518_02677

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_02677
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	MGYG000001518_7|CGC1	96809.73	4.6769

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 108206; End: 110761 Strand: +

Full Sequence      

MSNTVQNLDGWLFKASDDTAWQPARVPGCVHTDLLRNGRIPDPFYGTNERDLQWIDKKDW
DYEVAFDASAELLKETHQELVFDGLDTYADVYVNGRHVLAADNMFRSWRVDVTGLLKPEA
NTLTVHFRSPIQEDLPKLERLGYSLPAPNDLSELGGLGENRISVFARKAPYHYGWDWGPR
FVTSGIWREVRLEGWSGYRLTDLYIRQDEVTAEVARLTAVVEVEAEYAGPVLVHLMADDH
SWGQPVIVQQGRNQLEIPLTIEAPALWWCRGLGEAKLYTFRAALLADGREVSAKSVRTGL
RSVRLVREREAGGTSFYLELNGVPVFAKGANHIPNDSFVPEVTDERYRQEVATAVESGMN
MLRVWGGGIYEEDIFYELCDESGLLVWQDFMFACSMYPGDEAFLLSVRAEAEDNLKRLRN
HPSLALWCGNNEIDSAWAHFNENSGWGWKQQFTSEQREGIWHDYKEVFHRILPEAVERFM
PGMSYWPSSPLVELTDDKSQHTTGASPSGDVHYWGVWHNREPFENYNKNVGRFMSEYGFQ
SFPEYEAVLRYAEEKDMELESDVMQTHQKNGHGNLLIKDYMEQYLHEPKDFHSFLYLSQV
LQADAMAMGIEAHRRGKPYCMGTLYWQLNDCWPVASWASVDYYGNWKAVQYHAKRSFREV
MASVEENEGIVTVKIVSDLTEPFSGKLHVRLLDFHGVVQKEASAEVGLQPNEAKAVLSLN
RAEWLNGLGADKVFLLLELANEEQEPVDAKLHYFVHSKELKLASEPNIRVVSSVTEDGKG
TRLTLETDVLARQIWLSAEADGIFSDNFFDLVPGVPVTVDFLARTEGTTSYVPAEAGQVT
VRSMADFILLT

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	769	2.4e-110	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.02e-112	1	821	8	784	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	6.32e-20	770	846	4	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	1.41e-16	669	759	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10150	PRK10150	3.81e-09	76	435	80	420	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.08e-08	82	432	132	449	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB46050.1	0.0	1	848	1	844
QOT08284.1	0.0	1	848	1	844
ANY72641.1	0.0	1	848	1	845
ACX63524.1	0.0	1	848	1	844
QZN73770.1	0.0	3	851	2	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	2.67e-227	2	814	5	809	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	2.85e-227	2	814	7	811	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	2.94e-227	2	814	7	811	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	7.80e-227	2	814	5	809	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	3.41e-225	2	814	5	809	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	6.76e-130	11	819	13	836	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A2QYN2	8.60e-127	10	819	12	826	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q0CCA0	1.18e-126	10	664	12	658	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	3.40e-126	10	664	12	660	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	9.35e-126	10	664	12	660	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_02677.