CAZyme Information: MGYG000001518_03278

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_03278
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	MGYG000001518_7|CGC10	88661.32	5.9886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 823004; End: 825346 Strand: +

Full Sequence      

MTGRVVTKWNREWKFAEGNYAGAEQEGFTDSGWRQVDVPHDWSIEKPFDPHMPHGGFQAC
LPRWTVGWYRKRFFLEASSGPPRVYVQFDGVHHNSEVWINGHSVGKRPYGYVSFQYDLTP
YIRWDAENVLAVKVDNTPIPSDRWYSGSGIYRNVWLIRTNPIHVAEWGTFITTPRITPEA
AIVNAATTVVSHSEHDVECRIVTEVFDEDGKRATSMETREVLKAHETKEIRQEGEISNPE
LWSPELPVLYQARTTIIYDGKAHDSFSTTFGIREIRLDACSGLFLNGKRLKLKGVCLHHD
LGCLGAAYQDTAMKRRLETLKEMGCNAIRFAHNPMAPELLDLCDRMGFLVIDEIFDKWKS
LYYEHLFDEWWHKDLASALIRDRNHPCVFLWSVGNEVENQGQASMLAILDKLVAACHELD
PTRPVTCGLEPHNFPIRLREGSIEEKVEHTKELARHVDILGLNYQEQWYEAYREAMPDTL
IVGTETFPYYRGQGNRVKGYVPVNPWFDVVRHDYVIGQFVWAGIDYLGESVYPSKGWSSG
LIDTCGFRKPVSYLQQSLWSDQPVVQIAVFDDAGKQEFNPQWTMHWKAPAMVDHWTLPEY
AGKLLRLVTFTNCETVELVLNGESYGVRELAHFPDHLMIWHLPYNPGEIKAIGRNGGRIA
CEHSLATAGAACGIMLRADRQTLPADGQEIAHIEVTIVDAKGNRVPNPNVEVTVEAIGAG
RMIGIDNGDLTSDESYKGNRRRTRNGKCLVIVQSGQQHGELVLKASAEGLPEEEVRWIVE

Enzyme Prediction     

No EC number prediction in MGYG000001518_03278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	537	4.6e-121	0.5837765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.81e-60	1	426	7	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.42e-52	68	427	68	447	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	7.28e-40	674	776	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	3.74e-35	10	425	45	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	8.91e-29	66	425	121	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHC18253.1	0.0	1	769	1	769
QYK60303.1	0.0	1	776	1	776
QYK65486.1	0.0	1	780	1	780
APB72755.1	0.0	1	780	1	780
ALP36246.1	0.0	1	780	1	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.52e-169	13	771	14	769	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	6.58e-169	13	771	14	769	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7CWD_A	8.91e-163	10	770	7	792	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	8.52e-162	3	770	6	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.78e-157	10	770	31	811	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.39e-184	4	770	42	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	5.92e-110	4	729	46	769	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	9.58e-66	3	773	2	731	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	8.93e-52	4	706	26	724	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KPJ7	3.74e-51	10	654	57	705	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_03278.