CAZyme Information: MGYG000001518_03387

Basic Information

• Species: Gorillibacterium timonense
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Gorillibacterium; Gorillibacterium timonense
• CAZyme ID: MGYG000001518_03387
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		73871.58	6.591

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001518	5263339	Isolate	not provided	not provided

• Gene Location: Start: 947206; End: 949242 Strand: -

Full Sequence      

MPVFHFSKTLKRSMLSLLLLSLAVPPTAFPATKGEEAYAASQEEATHAVTAAAAFTASAS
ASAATAIAATSVATVATAATATSVAKAVEVSLPAIPEVMPYLAAAARASHTPVYSDRERT
RLLANLTAGEEYPVLSQDSSSIKLQLLDGKTGYVDKALMTLRPVKRYVLGWNAFADRETY
HQQNRVSDQLNVVSPRWYFLEKEDGPLSVSDDAAYVASSHTLGQEVWPLFGNRFDSDMTD
RFLKSADSRKAAIAAITASLKRTMADGINLDFENIQPDNKALFVTFVQELADALHPLGKK
ISVDVSRTNPDPYWSGSFDRRKLGEIADFIILMGYDEHWEGSPTAGSVSSLPWLREGVRL
LLNDVPGQKVILGLPFYTRDWAIPSSGSVSSEYMPITQAAELVKRLGLRKAWDSATEQNR
VSYTSSGVAHQIWLEDLDSMKRRTALIQDYALRGAAAWYMGEETADIWSAFQRISPAKPL
TSTVSFSDLKGHPAMDSVLALARDRVITGTAPNRFEPDRPVSRAEFAVLLSRLYIGGTPA
GTNAASGFSDVRSGSWYASSARFLTDLGVTTGYPGRRFLPDAPISREEMAVMISRLMTLT
ASFAPPSTAKQEELLRPFLDQGSLTWSRRSVAIALDQGIVKGQTSSHFGAERSATRAEAA
VMLARLQSWLEIHTDSDY

Enzyme Prediction     

No EC number prediction in MGYG000001518_03387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	223	464	2.1e-38	0.7567567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.04e-69	178	468	14	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	6.95e-51	185	468	122	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	9.73e-33	188	468	22	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.71e-26	230	458	78	329	Glyco_18 domain.
pfam00704	Glyco_hydro_18	7.95e-24	230	458	70	302	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALC88293.1	2.03e-113	144	471	154	481
AZV41490.1	7.49e-108	143	474	173	501
QUG43925.1	6.07e-105	142	471	152	481
QNU07185.1	1.19e-104	143	471	164	492
AXN41957.1	4.66e-104	143	471	164	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WIW_A	7.08e-25	171	466	10	338	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
3CZ8_A	1.17e-23	167	460	14	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	1.28e-23	199	468	141	418	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	5.22e-22	202	472	47	336	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	4.58e-20	234	468	182	420	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.98e-29	176	473	38	341	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	5.74e-24	157	460	88	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O31682	8.12e-24	169	396	11	224	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
P0DPJ9	2.18e-22	199	468	140	417	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
P37531	1.76e-20	221	468	165	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000844	0.998087	0.000465	0.000234	0.000183	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001518_03387.