CAZyme Information: MGYG000001519_00242

Basic Information

• Species: Olsenella sp001457795
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp001457795
• CAZyme ID: MGYG000001519_00242
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		38475.68	6.7217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001519	1818311	Isolate	not provided	not provided

• Gene Location: Start: 803; End: 1843 Strand: +

Full Sequence      

MPSRALHGVNLTGWLTLEPWVTPSLFADSGALDEDALIASIGSRRYHELVRAHRASFLGQ
DDFTRIAGRGFNAVRLAVPWYVFGAVGPHTGPYLGCLDYVDQAFDWAEEIDLKIVLVLAI
TPGAPAPDVPLVRNHDDFQHYRDDMLVVVGALAKRYAYRMAFAGIEPADDVIAQVRRGLS
LTDGVPLHVMRNYYRDAYETIRANAPDATIILPDAGQPGAWRHFMAPRRYHDVWLDCHLY
HYLDRAGGSGPTGIRRLSDASRRSLALARKSGLPVMVGKWSASLPFSDSSTTPEGRIALE
RVFVSEQIGAFEDCPAWFFNTWKTEGRLTSWDARAALSSFERAMLS

Enzyme Prediction     

No EC number prediction in MGYG000001519_00242.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	300	3.5e-37	0.8675496688741722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	8.36e-11	2	332	14	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.17e-07	60	283	27	239	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT48931.1	7.46e-189	1	346	1	346
ADK68544.1	8.57e-179	1	345	1	346
SDR87855.1	7.02e-178	1	346	1	347
QOY61077.1	1.23e-152	1	345	1	346
BBH50588.1	4.49e-139	2	344	17	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.92e-34	6	313	3	329	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	7.56e-34	6	313	3	329	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	4.28e-23	3	325	6	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	4.50e-23	3	325	11	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
3N9K_A	4.50e-23	3	325	11	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RAR6	3.32e-36	3	339	39	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
B0XN12	8.84e-35	6	339	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q5B5X8	3.80e-34	3	339	26	387	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q4WK60	8.73e-34	6	339	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1D4Q5	1.68e-33	6	339	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001519_00242.