CAZyme Information: MGYG000001519_00633

Basic Information

• Species: Olsenella sp001457795
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp001457795
• CAZyme ID: MGYG000001519_00633
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500	MGYG000001519_12|CGC1	56714.82	4.7713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001519	1818311	Isolate	not provided	not provided

• Gene Location: Start: 213662; End: 215164 Strand: +

Full Sequence      

MATFSNDFLWGGDISATQIEGGWDEGGKSPVETDYMVGVTHETPFRYGFYRNPDGSEGTM
QLYSGKLPKGAQMIIKEGYDYPNHKASDFYHHYKEDLALLAEMGFTALNLTMSWARIFPG
GISQGINSEGVEYYRSVLSECKRLGMEPIVTLYKYDMPFFYVSEWGGWSNRRLIEEYVEF
ARVCLTEFKGLSHHWITFNELNILKLTMDTLPDVTAEDRQRFFEEAHNQLVASARVVRLA
HAIDPDNLVGCMCAGLFGYGYTCDPNDQLKMQKYMQDAMFYYGDVMVRGAYPRFARRVWE
ENGVSLNVSAEDAADLMAGRVDFLPFSYYSSTCLTTHEIDASLVSGNASFSGVKNPYLAS
TPWGWEIDPVGFKIALHVLSDRYYDTPLLVVENGMGTLDRLEDDGSVHDPYRIEYLREHI
RNMREAVKEGVNLIGYTMWSCIDLISAGTGEMRKRYGFIYVDAADDGSPQGSYKRYRKDS
FHWYKGVCESNGEALAQAAP

Enzyme Prediction     

No EC number prediction in MGYG000001519_00633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	492	2.2e-124	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	6.46e-170	1	495	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	2.45e-165	1	496	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	2.74e-162	1	493	1	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	1.30e-155	3	495	5	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.76e-136	3	495	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASY54796.1	1.40e-226	3	495	2	491
QYN56930.1	1.26e-215	5	492	4	488
ARD07208.1	1.25e-201	7	496	9	494
QPL19376.1	1.51e-180	7	495	6	483
QPJ28030.1	1.51e-180	7	495	6	483

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	7.62e-140	1	495	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.16e-139	1	495	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.64e-133	7	495	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
6WGD_A	1.05e-131	4	495	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3QOM_A	3.08e-131	4	495	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	9.73e-139	1	495	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	2.54e-129	1	495	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	2.88e-128	3	495	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	6.69e-127	4	495	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	2.44e-125	3	495	6	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001519_00633.