CAZyme Information: MGYG000001519_01074

Basic Information

• Species: Olsenella sp001457795
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp001457795
• CAZyme ID: MGYG000001519_01074
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1094		122214.82	4.9552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001519	1818311	Isolate	not provided	not provided

• Gene Location: Start: 282943; End: 286227 Strand: -

Full Sequence      

MRAKHVTSELCYRNPFGAVQSGGAVSLSLDVWDEPAATARLRLWVDERGERLLDMRGRVE
GDHLRFSVTFVPDRPEVVWYSFQVQAADGAVWRYGAAREHACGEGAFAYGEPPSFQLTVY
DAGRGRLPAWYAQGVVYQIFPDRFARGAGWREQVEGDLATPYRGPERRLVERWDTYPSYE
RNADGSIAAWDFYGGTLEGIRERLDYLRGLGVSVLYLNPIFAASSNHRYDTVDYLRIDGA
LGTKEDFCRLCADAEARGISIILDGVFNHVGADSKYFNRAGVFAEPGAFQGDASPYRSWF
TFRDDGSYDAWWGVEDLPAVRDDSPEFRELICGYNGVVRTWLRLGARGWRLDVADELSDE
FIEDIKSAALAERPDVVVIGEVWEDASHKVSYGRLRHYFQGSELDGTMNYPLRSALLGFV
TNNRTAGELAATLQSLHENYPPQSFAGELNLLGSHDRRRLLTVLGDAPQADELTDDERRV
FRLGPDERSRAVSRLWVAALLQMCLPGVPSVYYGDEAGLEGYADPYCRATFPWGHVDEDC
FAIYRNAIALRRALPPLTDGSFEPFSQGDDVFGFWRRGEGGSVCVLVNASLTESHVVRIR
VDAPIADDVVSGARQEVRDGQVEVRLWPLGTAVIHPHEEVRLQRPLERGLGVMCHITSLP
NLERPGHAGTLGEPARRFIDTLARAGARYWQVLPVNPTDEFGSPYAGLSAFAGNVSLMWG
IDDDDGPSVLPTDFEGTSEFRRFVESNERWLLPYATFRAIKDRMGDAPWQEWPSRYRSWH
AGLPARRELKRGVRRVLGLQFAFMRQWGELRRYAHERGVAIIGDMPMYVSADSSDVWAER
ELFSLGEDGRPAEVAGCPPDAFAAAGQVWGNPTYDWERHRKDGFSWWLRRLARAFELYDY
VRLDHFLGFSSYFSIPAGASASEGRWNYAPGLELFKTAHERLGALPVVAEDLGSVTPAVR
ALTALTGFPGMDIIQFQDADVREGYHPAAGSVAYSSTHDTNTLLGWVVRRYGLHMTDSDD
RHAALDVARRLLSACADAPSDVVILPLQDLLLLGEGARMNVPGVACGNWQWQAEVGSLDA
AREVLHELVSESGR

Enzyme Prediction     

No EC number prediction in MGYG000001519_01074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	195	525	9.8e-120	0.9936708860759493
GH77	737	1076	5.5e-110	0.708502024291498

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14510	PRK14510	4.62e-180	1	1094	1	1220	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
cd11338	AmyAc_CMD	1.17e-176	133	562	1	389	Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins. Cyclomaltodextrinase (CDase; EC3.2.1.54), neopullulanase (NPase; EC 3.2.1.135), and maltogenic amylase (MA; EC 3.2.1.133) catalyze the hydrolysis of alpha-(1,4) glycosidic linkages on a number of substrates including cyclomaltodextrins (CDs), pullulan, and starch. These enzymes hydrolyze CDs and starch to maltose and pullulan to panose by cleavage of alpha-1,4 glycosidic bonds whereas alpha-amylases essentially lack activity on CDs and pullulan. They also catalyze transglycosylation of oligosaccharides to the C3-, C4- or C6-hydroxyl groups of various acceptor sugar molecules. Since these proteins are nearly indistinguishable from each other, they are referred to as cyclomaltodextrinases (CMDs). The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14508	PRK14508	2.31e-151	645	1094	2	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	2.72e-134	655	1071	2	455	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	1.85e-104	642	1071	8	490	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT48087.1	0.0	1	1094	1	1094
ADK68793.1	0.0	1	1094	1	1095
SDS02076.1	0.0	1	1094	3	1113
QOY60572.1	0.0	1	1094	1	1083
QUC03509.1	0.0	1	1094	1	1085

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X1I_A	1.29e-97	651	1094	8	499	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1FP8_A	2.49e-96	646	1078	3	482	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
1CWY_A	4.80e-96	646	1078	3	482	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
2OWC_A	7.07e-96	646	1078	6	484	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
5JIW_A	1.75e-93	646	1078	3	482	Crystalstructure of Thermus aquaticus amylomaltase (GH77) in complex with a 34-meric cycloamylose [Thermus aquaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16950	1.27e-102	4	634	254	918	Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus OX=1516 GN=apu PE=1 SV=1
P38939	1.57e-101	4	646	254	931	Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=apu PE=1 SV=2
P36905	3.46e-98	4	577	257	847	Amylopullulanase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=apu PE=3 SV=2
P0A3Q0	8.19e-97	647	1083	3	483	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	8.19e-97	647	1083	3	483	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999805	0.000226	0.000008	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001519_01074.