CAZyme Information: MGYG000001519_01401

Basic Information

• Species: Olsenella sp001457795
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp001457795
• CAZyme ID: MGYG000001519_01401
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		32656.47	6.501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001519	1818311	Isolate	not provided	not provided

• Gene Location: Start: 664553; End: 665449 Strand: -

Full Sequence      

MRRRARTPRRHGGLARRALIVATLVIVLVLGLRLTVCGGAATSWNAAETGRLKGKSLGIS
DVESLNLSPYSWDNVKKVNGRLAYVRDGETLSSFGIDVSEHNGDIDWKKVREAGVEFAYI
RVGYRGSIAGNIVEDARFARNMAEARSAGVKVGVYFFSQAKTEGEAREEADFATSKLGGA
DVDYPVAFDMEPDAAGSDRVSTLSGQELTTAARSFCDQCEKNGYHAVVYGNQYDLSQYDQ
AELARHGFWYAEYGTTPTSRLRFRLWQYTKTGTIPGIDGKVDLDLDLSGALDAEDAQR

Enzyme Prediction     

No EC number prediction in MGYG000001519_01401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	96	277	2.1e-45	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.79e-75	94	285	2	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.30e-40	95	285	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.82e-33	96	277	1	180	Glycosyl hydrolases family 25.
cd06413	GH25_muramidase_1	4.12e-32	95	283	5	186	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	1.05e-29	95	284	65	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKT49826.1	4.87e-116	65	295	1	231
ADK67502.1	2.93e-88	20	297	111	390
SDR65306.1	6.29e-88	54	292	155	393
QKF07386.1	3.82e-68	70	290	92	315
ACU95025.1	1.67e-66	65	285	99	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	1.52e-14	89	282	1	198	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	8.02e-13	95	284	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	2.41e-12	95	284	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	2.28e-13	89	282	78	275	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	2.77e-12	95	284	11	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	5.07e-11	95	284	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.882762	0.105376	0.008537	0.000684	0.000466	0.002186

TMHMM  Annotations     

start	end
13	35