CAZyme Information: MGYG000001520_00585

Basic Information

• Species: Vitreoscilla massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Vitreoscilla; Vitreoscilla massiliensis
• CAZyme ID: MGYG000001520_00585
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
440	MGYG000001520_6|CGC1	47248.48	9.8313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001520	3715034	Isolate	not provided	not provided

• Gene Location: Start: 131160; End: 132482 Strand: -

Full Sequence      

MNTVTSTRFRLAAALSLAVLLSACPTTKPIGGGPYTGGPKSALPPTPPGQVYGTPGQAVR
YTSAAFSQVPDWSGQSLKNSLLSFQRGCNQLGNKMQWQAVCQQAKITPLNDQAARLFFEN
LFTPWQLSDNGSNSGTVTGYYEPVLLGDTHPTAQARFPIYGIPTDFVSVPLSDDNRIRKG
QVRVAVTGANQGVISGNGSYSANLNAFPITDRSRSIKGRVVGNQFVPYYTRAEINAGALN
GKAPILAYANDAVELFFLHIQGSGRLQTPSGQFVRLGYADKNEYPFKSVATYMAGKGYLP
LAQTNMQGIKAWMRQNPSKLAEVLGQNPSYVFFRTTTGAADEGPIGALGAPLTGEYSAAV
DKHHVELGAPIFVATTHPLQNKPHNRLIVAQDTGSAIKGGVRVDYYWGYGDAAGEVAGKM
KHPGQVWLLLPNGYTPRYQP

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	147	334	1.9e-55	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	2.13e-117	70	438	36	372	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	4.58e-94	72	334	1	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	9.95e-65	147	334	3	157	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	4.11e-61	144	334	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	3.07e-40	124	429	104	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUZ06255.1	7.62e-252	6	440	9	448
QGL25118.1	2.91e-186	7	440	4	441
QMT42701.1	6.82e-184	6	440	2	447
QTM22892.1	1.07e-183	9	440	6	440
QMT37364.1	1.07e-183	9	440	6	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2G5D_A	5.47e-171	61	440	42	422	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	3.39e-167	61	440	42	422	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]
6QK4_B	2.91e-80	32	432	1	347	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
7ESJ_A	1.11e-71	24	433	2	361	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2PNW_A	3.23e-43	112	439	73	371	Crystalstructure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens [Agrobacterium fabrum str. C58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	1.41e-23	230	429	152	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	1.41e-23	230	429	152	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	1.28e-22	230	435	147	356	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P57531	3.24e-19	227	429	152	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q8K9A7	1.58e-18	231	429	164	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000009	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001520_00585.