CAZyme Information: MGYG000001520_02735

Basic Information

• Species: Vitreoscilla massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Vitreoscilla; Vitreoscilla massiliensis
• CAZyme ID: MGYG000001520_02735
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		20747.63	9.0541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001520	3715034	Isolate	not provided	not provided

• Gene Location: Start: 409450; End: 410007 Strand: -

Full Sequence      

MINRPQFFASIRSLFKRLSQSQVDGLNFLLDAFEQDGGLSAQEMAYMLATAYHETAATML
PIEEYGKGRGRKYGQNIDIDGSRYVGLPHVYYGRGYVQLTWLTNYKRAGDKICVDLVNHP
ELALNPTYAAQILIAGMREGWFTGKKLSDYINAKADYVGARRIINGTDKAELTAGYARQF
EAALK

Enzyme Prediction     

No EC number prediction in MGYG000001520_02735.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	40	131	2.7e-19	0.39826839826839827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	2.53e-07	42	142	47	151	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.72e-07	91	142	107	153	Chitinase class I.
COG3179	COG3179	3.74e-07	91	166	116	185	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADF97551.1	9.94e-78	8	185	8	186
QMP81468.1	2.25e-65	1	185	1	200
QNH60764.1	4.52e-63	1	184	1	191
AKG13483.1	7.50e-63	8	184	37	217
AKG11516.1	2.14e-62	8	184	37	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	1.07e-09	42	130	45	130	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3W3E_A	2.75e-06	36	122	50	141	Structureof Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata],3W3E_B Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata]
4OK7_A	3.37e-06	91	166	136	203	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4IJ4_A	4.05e-06	91	175	93	174	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
1WVU_A	4.09e-06	32	122	94	183	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001520_02735.