CAZyme Information: MGYG000001520_02954

Basic Information

• Species: Vitreoscilla massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Vitreoscilla; Vitreoscilla massiliensis
• CAZyme ID: MGYG000001520_02954
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000001520_10|CGC1	47903.54	9.2688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001520	3715034	Isolate	not provided	not provided

• Gene Location: Start: 617414; End: 618661 Strand: +

Full Sequence      

MNQLIDYLGLFVFLYPAVMAVYWGSTGLVYFLKQEKLSRGSKYADYPNYKYRTNPPLVSL
LVPCYNEADNIDESLPFLLKSNYPNLEIILVNDGSKDDTAKYIKRWSQAHNNIYAYYQKN
SGKATALNQVLKYARGKYVVCIDGDSILDMDAIDYLVHALEHNPEFVAVTGNPRVRNRST
LLGRLQVAEFSSIIGLIKRSQSTLGSIFTVSGVVCAFRRDALLQVGGWSKDMITEDIDIS
WKLQVQGNRIGYEPRALCWVLMPETVRGLYKQRLRWAQGGAEVFIKYFRQVFTWNNRKMW
HLYIEYIISALWAYSLALLTILAGISLVQDYGNYYPFLVLSSFFLIAIFCLQMAVSLYID
SHYEHHLKRYFISSIWYPYIYWVLNALTLILGIPKAITRDKDKLAVWTSPDRGIR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	56	277	1.4e-34	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03937	PgaC_IcaA	0.0	8	413	1	407	poly-beta-1,6 N-acetyl-D-glucosamine synthase. Members of this protein family are biofilm-forming enzymes that polymerize N-acetyl-D-glucosamine residues in beta(1,6) linkage. One named members is IcaA (intercellular adhesin protein A), an enzyme that acts (with aid of subunit IcaD) in Polysaccharide Intercellular Adhesin (PIA) biosynthesis in Staphylococcus epidermis). The homologous member in E. coli is designated PgaC. Members are often encoded next to a polysaccharide deacetylase and involved in biofilm formation. Note that chitin, although also made from N-acetylglucosamine, is formed with beta-1,4 linkages.
PRK11204	PRK11204	0.0	4	415	6	419	N-glycosyltransferase; Provisional
PRK14583	hmsR	2.04e-141	11	414	33	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	1.43e-67	7	402	10	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	6.17e-64	60	236	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG82231.1	3.01e-172	5	414	3	411
AHG85954.1	3.01e-172	5	414	3	411
AGH37969.1	1.73e-171	5	414	3	411
AHG84544.1	1.73e-171	5	414	3	411
QOR15635.1	3.30e-167	2	414	3	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	1.15e-21	17	289	8	273	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	1.16e-21	17	289	9	274	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5HEA_A	4.55e-17	54	169	3	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5EJ1_A	3.34e-14	56	285	128	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	3.51e-14	56	285	140	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	1.27e-113	11	414	33	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	1.27e-113	11	414	33	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HKQ0	1.57e-104	11	413	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	4.45e-104	11	413	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q8NUI7	7.26e-100	11	413	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
300	322
337	359
371	393