CAZyme Information: MGYG000001520_03028

Basic Information

• Species: Vitreoscilla massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Vitreoscilla; Vitreoscilla massiliensis
• CAZyme ID: MGYG000001520_03028
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		29305.44	9.7285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001520	3715034	Isolate	not provided	not provided

• Gene Location: Start: 684593; End: 685363 Strand: -

Full Sequence      

MFKSLKNVMACLLGLVLVFQCYAYGSILFWRSFAPPTTSFMFTRSLEYRDEPVKYQWVSY
GNISNNLKQAVIASEDAAFTNHDGFDWRGIENAMKRNQRAGEIKAGGSTISQQLSKNLFL
WEGKSYVRKAEEAAITLMMEATTDKERIFEIYLNVIEWGPNVFGAEEAARFHFDKSADSL
SKQQAAKLAAMIPRPRYYSDNPKDRNLRGKTNIILRRMGASALPDSDPMFQLPNLNKLTQ
PQEEAAPKHHRRHHKE

Enzyme Prediction     

No EC number prediction in MGYG000001520_03028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	218	1.9e-57	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.09e-114	1	225	1	230	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.37e-92	6	224	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.30e-71	10	246	26	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	9.00e-69	52	218	10	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.20e-34	1	218	1	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUZ04758.1	1.23e-135	1	238	1	238
QGL25538.1	3.42e-90	1	227	1	231
QMT44812.1	1.66e-89	17	227	14	228
QRQ81692.1	3.57e-89	3	227	2	230
ATD65568.1	3.95e-89	1	227	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.66e-30	57	218	22	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	5.14e-30	57	218	22	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	2.22e-22	50	215	22	189	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	5.73e-22	50	215	31	198	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3UDF_A	1.47e-21	58	218	42	202	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4RJ59	6.43e-89	1	227	1	231	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae (strain NCCP11945) OX=521006 GN=mtgA PE=3 SV=1
Q5F6F6	6.43e-89	1	227	1	231	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mtgA PE=3 SV=1
Q51005	6.43e-89	1	227	1	231	Biosynthetic peptidoglycan transglycosylase OS=Neisseria gonorrhoeae OX=485 GN=mtgA PE=3 SV=1
A9M2N3	1.83e-88	1	227	1	231	Biosynthetic peptidoglycan transglycosylase OS=Neisseria meningitidis serogroup C (strain 053442) OX=374833 GN=mtgA PE=3 SV=1
P0A0Z3	7.42e-88	1	227	1	231	Biosynthetic peptidoglycan transglycosylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.718645	0.277044	0.001934	0.000759	0.000395	0.001223

TMHMM  Annotations     

start	end
12	34