CAZyme Information: MGYG000001522_01780

Basic Information

• Species: Pauljensenia radingae_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia radingae_A
• CAZyme ID: MGYG000001522_01780
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000001522_5|CGC11	53590.51	4.4505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001522	2458350	Isolate	not provided	not provided

• Gene Location: Start: 927960; End: 929417 Strand: -

Full Sequence      

MHAGDALNYLSNVRPSFRQLRWQEMEMYAFIHFGMNTMTDREWGEGHEDPALFTPGNVDT
DQWMRALKDAGMTGVILTCKHHDGFCLWPSAYTDHSVASSPYQGDIVAQASESARRFGLK
FGVYLSPWDRTEATYGQGVAYDDFFVNQLTELLTNYGPIFSIWFDGANGEGENGKVQYYD
WERYFTLIRALQPEAVINICGPDVRWCGNEAGVARPAEWSVLPAELQSAERTQEHSQKAD
DGTFSREVKSTDEDLGSRAALANYDGPLVWYPAEVDTSIRTGWFHHAAEDEHVRTPDELF
AIWHGSVGGNCSLLLNVPPTRKGVLAQPDIDSLKGLGDLVRDFYARRISTVTVDASTSTV
PDTLTAQAGTPFDDSYDPLIPALLTAPYWQPDEGDSAPTLTISFDRSTPVSAVIIREAIA
EGQRIDRVTVRGTCPNGTTVDLGSANSVGYQRIISFDPVELASITVSVEQSRGSVRLAHV
WPVSA

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	19	339	6.8e-78	0.8497109826589595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.41e-55	15	466	11	413	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.44e-33	53	338	79	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	7.42e-32	44	338	66	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU07649.1	0.0	1	485	1	485
QOL44541.1	3.63e-210	3	472	7	465
QSZ18101.1	1.47e-209	3	472	7	465
QTB92446.1	1.47e-209	3	472	7	465
QSP97854.1	1.47e-209	3	472	7	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UES_A	2.52e-209	3	472	7	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	3.37e-207	3	472	7	465	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	1.12e-203	3	472	9	467	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	9.65e-124	15	480	32	455	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	2.28e-88	15	472	39	452	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	5.98e-94	15	480	38	474	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.95e-91	15	472	40	465	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	3.61e-08	59	166	106	223	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q6AYS4	8.37e-08	22	169	70	224	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	6.00e-07	22	169	72	226	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001522_01780.