CAZyme Information: MGYG000001522_02056

Basic Information

• Species: Pauljensenia radingae_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia radingae_A
• CAZyme ID: MGYG000001522_02056
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313		32783.15	5.2453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001522	2458350	Isolate	not provided	not provided

• Gene Location: Start: 1236467; End: 1237408 Strand: -

Full Sequence      

MSVKKLVGILAAIPLTVIPLMMAGGEEERAASLSGVPAEYLAAVMKAGSICEEITPSLIA
AQIEAESGWDPHAVSPMGAQGIAQFMPGTWKTRGIDADGDGTADPFNPDDAIASQGAFMC
ALVEIVTGYTRSGQADGNTIDLALAAYNAGPGAVQQHGGIPPFTETQDYVARIKRLAGKY
TQASPSSSSVVATAQKYFGVPYVWGGTSPSGLDCSGLIVRVYADLGKPLNVRTAHDIITT
AGTTIAQDAMQPGDLIGFAYHGSTHYHHIGIYAGKDPQGHRLMIHAPDVGGHVEQVSLDT
AYWLGMTWTTIRI

Enzyme Prediction     

No EC number prediction in MGYG000001522_02056.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	183	1.9e-31	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	4.89e-39	53	177	2	106	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd00254	LT-like	1.71e-32	56	173	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam00877	NLPC_P60	1.27e-23	199	303	1	96	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	1.84e-20	143	303	30	189	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	2.97e-20	37	175	1	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT86054.1	1.33e-225	1	313	1	313
VEG28534.1	4.13e-79	18	298	251	522
AWI31253.1	2.11e-71	24	312	38	336
VEI18427.1	6.89e-71	8	274	4	276
VEG29992.1	9.03e-71	15	300	8	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	8.63e-14	184	303	25	133	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
4XCM_A	5.35e-12	182	303	109	220	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
3H41_A	6.47e-10	184	300	186	296	CRYSTALSTRUCTURE OF A NLPC/P60 FAMILY PROTEIN (BCE_2878) FROM BACILLUS CEREUS ATCC 10987 AT 1.79 A RESOLUTION [Bacillus cereus ATCC 10987]
7CFL_A	1.30e-07	187	303	14	127	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
4FDY_A	3.10e-07	194	303	198	300	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	1.13e-16	54	193	1435	1554	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.13e-16	54	193	1435	1554	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	1.14e-16	54	173	73	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O35010	1.29e-12	181	302	167	283	Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase OS=Bacillus subtilis (strain 168) OX=224308 GN=ykfC PE=1 SV=2
P13692	9.67e-12	184	303	399	507	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001320	0.975525	0.022492	0.000231	0.000205	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001522_02056.