CAZyme Information: MGYG000001523_00367

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_00367
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000001523_9|CGC1	31867.02	5.3352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 193942; End: 194790 Strand: +

Full Sequence      

MRKIYLLTLTFCIFFAMAPGSITASEKTEPAPPGYDEYRSGIPHGEMNMITYYSTTVGVN
RNALVYTPPGYSPKKKYNVLYLLHGIGGDENEWNDQMNPQNILDNLYAENKLEPMIVVFP
NGRAMEDDRPIGDIFDPEKIAAFERFEGDLLNDLIPHIESEYPVWKNRHHRALAGLSMGG
GQSLNFGLNNLDTFSWVGAFSAAPNTKAPEELLVDPKKISKRLHLLWLSCGDEDGLLSIS
ENFHNSLTENNIPHKWYLDQGGHEPAVWSSGLYHFSQQLFKK

Enzyme Prediction     

No EC number prediction in MGYG000001523_00367.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	54	275	1.6e-55	0.960352422907489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	2.12e-45	17	282	42	298	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.07e-17	54	272	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	6.97e-13	65	272	39	301	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	2.33e-12	40	203	4	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG3509	LpqC	5.86e-06	57	210	43	189	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AET58179.1	9.33e-141	24	281	42	299
APB68912.1	2.67e-140	24	281	42	299
QYK64837.1	3.79e-140	30	281	48	299
QDY84819.1	1.54e-139	24	281	42	299
ASR45407.1	2.18e-139	24	281	42	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JJF_A	6.41e-74	24	277	10	255	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.82e-73	24	277	10	255	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	6.00e-41	34	281	125	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6RZN_A	8.79e-40	38	281	123	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6MOT_A	1.77e-34	34	281	103	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	8.77e-68	24	277	29	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	5.11e-37	26	282	410	671	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	3.16e-32	32	281	129	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	5.86e-26	38	281	491	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P51584	3.95e-14	19	233	800	1017	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998963	0.000228	0.000154	0.000146	0.000142

TMHMM  Annotations     

start	end
5	24