CAZyme Information: MGYG000001523_00569

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_00569
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000001523_10|CGC3	90454.29	5.2896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 95343; End: 97766 Strand: -

Full Sequence      

MKYKDIIAEMTLEEKASLMSGKDYWQTQDIERLGIKSIFLADGPHGIRRQAVAADKLGLN
EGVPATCYPTAATVANSWNVELGEKVGEYLGEEAIEQNVNVLLGPGINMKRNPLCGRNFE
YFSEDPYLTGKMAAGYIRGIQSFGVSACVKHFAVNNQEEKRMTIDTIVDERALREIYLTA
FEIAVKEGNTKAIMSSYNKLNGTYTNENTHLMQDILRGEWQYDGTVITDWGGSNDRIEGL
EAGNELEMPTTGGETDQEIVAAICNGDLSEDILDKSVDRLLDLIFTTQNAYKKPKIDFDI
EKHHRVSQKVAEESIVLLKNDQEILPLKFGKKVAVIGDFAKDARYQGAGSSIVNPTILDH
TMDCFEESGIINIGYEPGFERYGKKDPKKIENACELAKQADVVLLYIGLDEVTEAEGLDR
KDMKIPENQIELLEALHAVNPNIVGIISCGSAVEMPWIDKVQGLLHGYLGGQAGARAILR
VLSGDVNPSGKLAESYPLKYEDTPSYQHFPGKEATVEYRESIYIGYRYYDSADVDVLFPF
GFGLSYTTFEYSDISVDKNGVSFKLTNSGSKAGMEVAQLYVGCKSGNIFRAKKELKGFIK
VFINAGETKTVRIPFNDNTFRYFNVKTNQWEIEKAEYQIMIGASSADIKLQEEVFMEGTN
APLPYVKELLPSYYKGQVNQVPSDEFEHLIGEKLPDPNWDRDKPLGYNDMIAQCHYAKGV
FGRLLYKSVLFSHWFLRKIGKRSTANLIMMSIYNMPFRGIARMTGGMVNMPMVDGILMMV
NGRFFKGFFHLLKEKFKLAKAKNPKTL

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	4e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.16e-83	32	652	101	761	beta-glucosidase BglX.
COG1472	BglX	4.57e-72	26	342	49	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.22e-55	315	546	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.08e-42	6	570	56	652	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.46e-34	26	283	55	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST96263.1	0.0	1	803	1	803
QNM42622.1	0.0	1	803	1	803
AZK49185.1	0.0	1	801	1	801
AOZ92944.1	0.0	1	807	1	808
QHZ46303.1	0.0	1	803	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.79e-237	4	659	6	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.96e-192	7	664	9	671	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.18e-143	2	651	3	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.89e-142	2	651	3	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.60e-122	4	658	7	844	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.81e-236	4	659	6	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.48e-190	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.88e-190	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.44e-141	1	649	44	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	3.34e-134	4	660	12	842	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999644	0.000390	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001523_00569.