CAZyme Information: MGYG000001523_01720

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_01720
• CAZy Family: GT0
• CAZyme Description: UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40959.1	8.1008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 163385; End: 164452 Strand: +

Full Sequence      

MRIVFRVDSSYQIGTGHVRRCLVLAEQLRKREAEVTFICHNFPGNVNHFIKERGFSLVEL
SYLENQPKKCIQKNWKLDASNTLELIRQYSTVDYLVVDHYGLDEKWEKNVASYVQHLMII
DDLANRNHYCDTLVDQNLLENMEKRYVDLVPDKATLLLGPKYLLLREEFKQTLPIDKSNQ
YIRNIFVSFGGTDPTNDTYKTLKALIQLSNHPFTINTIISTNHPDFKQIQALANNYPSVC
IHTDTNQMALLMKKADLAIGAGGTTTWERCYLQLPTLTIETAPNQRDILNHLDSIGFLLN
LGESSNVSTDKIKIAVQSFLNDPKEWKHMKRRLKLFRTRVVDEAVACYMVKGECK

Enzyme Prediction     

No EC number prediction in MGYG000001523_01720.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03590	PseG	1.72e-79	2	285	1	272	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
COG3980	SpsG	1.46e-55	1	302	1	275	Spore coat polysaccharide biosynthesis protein SpsG, predicted glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.68e-06	184	293	1	108	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
cd03785	GT28_MurG	2.01e-06	14	334	8	336	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd17507	GT28_Beta-DGS-like	1.16e-05	202	346	212	356	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35221.1	8.21e-111	1	351	1	349
QIQ33446.1	1.70e-96	1	332	1	339
QSB47881.1	4.81e-96	1	332	1	339
AEG59495.1	5.31e-93	1	331	1	342
QJC98005.1	9.09e-91	1	342	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HBM_A	8.49e-21	2	297	2	268	ChainA, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819],3HBN_A Chain A, UDP-sugar hydrolase [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58462	2.30e-27	1	287	1	276	Uncharacterized protein MJ1062 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1062 PE=1 SV=1
A1W0U6	4.61e-22	1	297	1	268	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) OX=354242 GN=pseG PE=3 SV=1
Q0P8U5	8.76e-22	1	297	1	268	UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pseG PE=1 SV=1
P39627	1.48e-12	1	302	1	284	Spore coat polysaccharide biosynthesis protein SpsG OS=Bacillus subtilis (strain 168) OX=224308 GN=spsG PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001523_01720.