CAZyme Information: MGYG000001523_01983

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_01983
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000001523_12|CGC1	27742.43	4.2951

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 455483; End: 456190 Strand: +

Full Sequence      

MKKQMQWISIVLVLVVASVSYYQINSYEEEMQALKQDNVELEQEIDTMESQAMYILNQSD
QKEVKLTHETWPEYFNVAEVMVKESDGEFLRPWAIYLVKEAEKYDIDPFIVYELLKVETG
RTFDPELVGPETKYGHAYGMAQFMKNTAPWIAEMAEMPYEEKLLFDPYYSIKLSLVYLDY
LYDQYDNWDETLTAYHRGMAGMEQYKLKNGHANSEYAVRIQTNAQKYKDFVAFAN

Enzyme Prediction     

No EC number prediction in MGYG000001523_01983.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	106	227	8.9e-16	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.94e-17	96	199	7	106	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.66e-13	99	198	3	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.61e-12	89	187	2	95	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.07e-11	61	223	105	264	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	1.30e-11	108	225	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH34948.1	1.74e-141	1	234	1	234
QHE54327.1	1.09e-79	27	234	19	226
QAS54711.1	2.34e-79	68	227	63	222
QTN01506.1	4.70e-79	24	235	19	229
QST01941.1	5.22e-79	27	234	4	210

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.807712	0.164982	0.020230	0.000748	0.000483	0.005861

TMHMM  Annotations     

start	end
7	24