CAZyme Information: MGYG000001523_03048

Basic Information

• Species: Gracilibacillus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_D; Amphibacillaceae; Gracilibacillus; Gracilibacillus massiliensis
• CAZyme ID: MGYG000001523_03048
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
881	MGYG000001523_13|CGC13	99823.67	4.4119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001523	4207224	Isolate	not provided	not provided

• Gene Location: Start: 585085; End: 587730 Strand: -

Full Sequence      

MLQVQDLRTEYRKNPIGIDVTAPRISWKLSSDKRNVMQASYQIQVAEDDAFEKLVWNSGK
VDSDKSNFIALTGVQLESRARYYFRVKVTDTKENVSEWSDSSYFEMGLLNKDEWVADWIA
APLKWNGEPAPKLARSFQVNGNVKKARIYVTALGLYELQLNGKRVGEDYFTPGWTSYQSR
LQYQTYDVTDLIASGDNEITGLLGNGWYKGNLAWEGRENVFGDRLSLLAQIHIELENGEE
LLVATDDKWAATESSIRMSELYHGETIDASFETDQTEAVEILEHSYDILVAQENEPVRKI
ETLSPKELIQTPNGETVIDFGQNMVGWVSFDIEGEAGQEVQMKHAEILDGEGNFYTANLR
TAKQTNTFILSGNGKETFEPSFSFQGFRYVQLIGFNDNQLHLKKFRGVVLHSDMEITGDF
KSSDPIINQLQHNILWGLKGNFLDVPTDCPQRDERLGWTGDAQMFIRTASYIANVGPFFT
KWLRDVEADQDKEGGIPFVVPNVLEDMEEPHENTVQKPFSSAAWGDAAVICPWTLYLAYG
DKRILEEQYHSMTLWISYIKNQGENPYLWNTGFHFGDWLALDAKPDSYVGATDRSYIATA
FFAYSTSLVKRIAKIIGKEEDYSYFAELQENIIQAFTDEFITPNGKIAVPTQTAQILALM
FNLVDTKAKERAVEKLEELLEESNYHLTTGFVGTPYLNHVLTENGMNDAAYTLLFQKDYP
SWLYQITKGATTIWEHWDGIKEDGSFWSTDMNSFNHYAYGAIGDWLYRKVAGLELDEEIP
GFKHFTVKPYIGDGLEWAEATLESMYGEIKSGWKKDDTGNMQLEIIVPPNTNATVKLLGV
EGNDVKENGKELSQAEGVLSVNHQDGEVAISLGSGKYLFTY

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	309	837	2.4e-182	0.996031746031746
CBM67	116	274	1.9e-26	0.8465909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.41e-137	417	770	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.42e-57	143	301	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.60e-37	309	411	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.18e-20	775	850	2	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI31680.1	0.0	1	881	1	883
QJD88419.1	0.0	1	881	1	888
QTH41476.1	0.0	1	881	1	888
AJY74255.1	0.0	1	881	1	883
QGQ95048.1	0.0	1	881	1	884

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.80e-185	2	880	4	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.00e-178	2	845	2	854	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	5.92e-157	6	879	34	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.55e-192	13	879	45	920	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.07e-184	2	880	4	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	4.53e-176	14	833	42	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.21e-117	12	881	40	949	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001523_03048.