CAZyme Information: MGYG000001524_01213

Basic Information

• Species: RUG013 sp001486445
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; RUG013; RUG013 sp001486445
• CAZyme ID: MGYG000001524_01213
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		39702.47	6.1312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001524	2090171	Isolate	not provided	not provided

• Gene Location: Start: 790814; End: 791836 Strand: +

Full Sequence      

MKTISFAVPCYNSAAYMDKCIESLLRCGDDIEIILVNDGSQKDDTSEKAHEWEVKYPGII
RAIDQENRGHGGAVNHGLAEATGLYFKVVDSDDWLDDMAMLRVMNYLRRQVERKDPTDLV
VANYVYEKVHENASIVMNYRNVFPVGEEFTWDEVGHFRQSQYLLMHSVIYRTQLLKDCGL
QLPEHCFYVDNIFVYVPLPHVRTLYYLDADMYRYFIGREDQSVNEKVMLSRVDQQLRITK
VMIDAVDPIEDVPQPKLAHYMENYLSMMMCICSVFLRMGGTEEDERKRADIWDYLRARDE
RLYRHVRRSVLNMGTNLPTKAGRKLGLGGYHIAQKIFKFN

Enzyme Prediction     

No EC number prediction in MGYG000001524_01213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	133	1.5e-25	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	2.36e-24	5	132	1	123	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.52e-23	8	166	3	148	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.97e-21	1	103	2	104	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06423	CESA_like	1.39e-16	8	104	3	100	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK10073	PRK10073	2.42e-16	4	223	8	222	putative glycosyl transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANE22817.1	2.30e-203	1	340	1	340
ACU94346.1	1.82e-193	1	340	1	340
ACV55691.1	1.43e-183	1	340	1	340
QOS66858.1	1.66e-182	1	340	1	340
BAK44469.1	2.75e-181	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.74e-11	4	97	7	99	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z87_A	1.52e-09	4	111	376	482	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.53e-09	4	111	377	483	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR96	7.92e-12	4	124	5	120	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
A0A0H2URH7	8.71e-12	4	175	7	212	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P71059	3.49e-11	4	214	5	211	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
Q8L0V4	8.70e-09	4	111	434	540	Chondroitin synthase OS=Escherichia coli OX=562 GN=kfoC PE=1 SV=1
Q7BLV3	2.96e-07	4	166	442	588	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001524_01213.