CAZyme Information: MGYG000001525_01208

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_01208
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1329	MGYG000001525_17|CGC3	139971.81	4.4818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 198500; End: 202489 Strand: -

Full Sequence      

MKSQSQRRIIAWICVVTLFAATFFTSAGWTPPVQAAGGSNLAAGKTASESGHADVYTASN
VTDGNADTYWESTNNAFPEWVQVDLGSATQIDQVVLKLPAGWESRSQTLSVQGSTNGSSF
TDLKASASYTFDPAAANQVTINFTTASVRYVRIQITANTVWPAGQLSEVEVYGASPAAPS
VIPGKIEAENFTAMNGIQTEPTSDTGGGLNVGWIHVGDWLDYNVNVVSAGTYTVEYRVAS
NVSTGAIQLQSGGTTLATTTVPNTGGWQNWQTVTANVTLSAGTQTLRVYASGYDFNINWI
AFTAGTSGADTQSPTAPADLAFTQPTSGSIKLTWSAATDNVGVTGYDIYANGQLRASVNG
SALTYTDSQPDGVTVSYYVVAKDAAGNASAPSNTVTRTGSTGGEEGSNLAIGKTITASSS
TFTFVAANANDNDISTYWEGNGHPSTLTVDLGANANLTSIVLKLNPASDWATRTQTIQVL
GHNQEATSFTNLVSAASYTFNPASQNTVTIPVSATVSQVQLRFTANTGAPGGQVAEFQIF
GTPAPNPDLTVTNLSWSPASPDETQAVTLNATVRNAGTVASGATNVNFYLGSTLVGTAPV
GALAPGATANVSANIGAKEAGSYAVVAKVDENNAVFETNEGNNSYTHTSQLTIGQVQSSD
LIATAVWTPSNPSAGNTVTFTVNLKNQGTIASAGGAHAITLELKNGSGATVQTLSGSYTG
SLAPGASTNVTMGTWTAVNGSYTVTTTVAADANEVAVKRNNNTATASLYSGRGANMPFTV
LEAEASSNNTNGTKLAPNFTPGDFAGEASGRSAVYLDATGEYVEFTLTSPANAFVLRNAV
AENTTGTVSIYANGVDKGNFTVTSKFSYLYATPSTLGRLGYDNSGSKAYWLYEDSQLLLD
QVYPAGTKIRIQKDAGDVPWIYVDMIETENVAPPATNPDPSKYVQVSSTKSIEQALNEFR
QDSSKKGIFIPAGEWTISSKIFLYGRATEIIGAGPWHTKLVAPQDQTNTDVGFNISSAAN
GSTIKDLSAWGNYIYRQDGPGKFIDGNGMQNVTIENVWAEHFVCLYWGVNSSHNTFKNNR
IKNMFADGINMTNGSSYNVIDNNYARGTGDDSFALFSAIDAGGSYNVGNKYTNLTAVNVR
RAAAFAVYGGQNNLFQNLYGADTLTYPGVTISSLSFGYNTLGFGDQDTVIDGVTLDRTGG
DFWTSVGADDKINDYQNFGAIWFYGGDRDFKNILVKNVDINNPVYFGLMFQSKSPENLPM
QNVRLENITINNPTRYGIKLVVRAEDGQGPAVGEASFTNVKVNNPGITAIYGENQSPNFH
VIRGAGNNW

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	705	1311	5.9e-145	0.9581239530988275
CBM6	187	303	3e-35	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	3.98e-52	773	928	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04080	CBM6_cellulase-like	5.09e-46	182	303	1	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
smart00606	CBD_IV	5.37e-35	181	302	3	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	1.79e-32	187	304	1	125	Carbohydrate binding module (family 6).
cd04079	CBM6_agarase-like	5.27e-25	185	303	5	133	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANS76644.1	0.0	4	1329	5	1330
QTH42681.1	0.0	3	1329	4	1328
AYQ75762.1	0.0	22	1329	5	1309
QMV42812.1	0.0	4	1329	5	1328
AZS18146.1	0.0	15	1329	1	1316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K0Q_A	0.0	765	1329	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0M_A	0.0	765	1329	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	0.0	765	1329	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	0.0	765	1329	6	573	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
7C7D_A	5.90e-37	773	1327	54	575	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q27082	1.16e-17	186	303	413	533	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
P20533	3.91e-15	303	395	549	640	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P27050	7.51e-11	305	412	84	194	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
P36909	9.45e-09	202	415	41	241	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
Q8GJ44	5.05e-08	186	322	389	526	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001252	0.997738	0.000312	0.000319	0.000194	0.000165

TMHMM  Annotations     

start	end
9	31