CAZyme Information: MGYG000001525_01660

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_01660
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685	MGYG000001525_17|CGC17	80034.84	7.0303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 716633; End: 718690 Strand: +

Full Sequence      

MNRLWESVISPIIQHVSPKHIVEVGSEEGKTTRKILEYCIESDCILSAIDPKPLFNVQEL
VEQYNGKFFFYKDLSLNKIYELENFDIILLDGDHNWYTVFHELKMIDKQSGKSKFPIVFL
HDSGWPYGRRDLYYNPELIPSNFLKPYKKQGIVPWQHDLVDIGFNMNLNNSIYENNDRNG
VFTAVEDFLKETSKEVYHYNIEAFHGLTILFGKENKDIIDSIDVKKLTGDLEYERVNLLA
KNRINILKKNELMQEMKESKKLDVLNEEIKNDIDDKIKEIEQLKNKELVLTKQINEYQEI
IDKYKEKQLLLENKITRSENLLEELRKEKDKLEIVNRKRIHELKKRIADVKNEIRESASY
RLGSILVNGLRNPIAFVKIPYNILKLYNEKHNRQKSIDLGVEKIDITEEKKYTPPTIIVP
IYNAYEELKDCLKSIIDNTSEKYNLLLINDCSTDERIERFLELYRDLPQVTVINNTKNLG
FIKNVNYGMNSVQTDVILLNSDTIVTPGWVRKLIDAAYSSSNIGTVTPLSNNAGPFSVPE
PNYNVLPNDFTVKRMGEIVEKAGVNSYLEVPTGHGFCMYIKRRTIEDVGLFDDNTFGKGY
CEENDFCMRALKKGWKNIVDDKTYIYHTESASFMESKAKIREINRLKLVDKHPEYPKLVK
AFVTSKELKQIRERVKHELNKNVKH

Enzyme Prediction     

No EC number prediction in MGYG000001525_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	416	526	2.1e-21	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	6.64e-34	417	627	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.93e-28	416	659	6	254	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.56e-21	416	517	1	103	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.37e-20	417	531	1	116	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06423	CESA_like	1.31e-16	417	597	1	178	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB55815.1	1.29e-135	1	683	1	852
AWX32257.1	9.33e-82	384	684	1494	1793
ABC56892.1	3.42e-75	394	680	799	1082
ACM59219.1	2.05e-73	381	669	398	701
SDS94867.1	8.69e-71	417	663	8	256

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57287	8.78e-10	416	514	8	107	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
P39614	1.43e-06	416	612	4	184	Uncharacterized glycosyltransferase YwdF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywdF PE=3 SV=1
O34319	2.06e-06	416	515	8	111	Uncharacterized glycosyltransferase YkcC OS=Bacillus subtilis (strain 168) OX=224308 GN=ykcC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_01660.