CAZyme Information: MGYG000001525_01975

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_01975
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
765	MGYG000001525_18|CGC9	83078.78	4.6595

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 348856; End: 351153 Strand: +

Full Sequence      

MLYKDRSKPVPERVEHLLGLMTLEEKAGQLIQPFGWQTYEHKDGEIRLTESFKEQVQSGG
IGSLYGVLRADPWTGVTLETGLSPREGAEAVNAIQRYAIENSRLGIPILIGEECSHGHMA
IGATVFPVPLSLGSTWNVELYREMCRAVARETRAQGGAVTYSPVLDVVRDPRWGRTEECF
GEDAYMIGEMAVASVEGLQGESLDGEDSVAATLKHFVGYGSSEGGRNAGPVHMGRRELLE
VDLLPFRKAVEAGAASIMPAYNEIDGVPCTTNEELLDGILRGEWGFDGMVITDCGAIDML
ASGHDVAEDGRDAAIQAIRAGIDMEMSGVMFGQHLVEAVRSGQLEEEVLDRAVRRVLTLK
FRLGLFEQPYADPARAERVIGSTEHVELARKLASEGIVLLKNEGGVLPLSAKAGKIAVIG
PNADVGYNQLGDYTSPQPRSKVTTVLGGIRSKLANTPERVLYAPGCRINGDSREGFDVAL
SCAEQADTVVMVVGGSSARDFGEGTIDLRTGASKVTGNTESDMDCGEGIDRMNLSLSGVQ
LELIQEIHKLGKPLVVVYINGRPIAEPWIDEHADAILEAWYPGQEGGHAIADILFGDVNP
SGRLTISVPKHVGQIPVYYHGKRSRGKRYLEDDSQPQYPFGYGLSYTEFTYSNLSLESDT
LSVDGTTKVTVEVTNAGDRAGAEVVQLYISDIASIVTRPSKELKGFRKIFLQSGETQKVE
FEIGPEQLQYIGRDYKAVVEPGEFRVHVGKNVNDTLSANLFVREV

Enzyme Prediction     

No EC number prediction in MGYG000001525_01975.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	326	2.7e-76	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	14	749	38	751	beta-glucosidase BglX.
COG1472	BglX	1.14e-108	21	468	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.39e-91	5	725	44	744	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.20e-84	22	359	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.56e-74	397	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS13463.1	0.0	1	764	29	792
ACX64155.1	0.0	1	764	1	764
AYB45493.1	0.0	1	764	1	764
QOT07701.1	0.0	1	764	1	764
ANY72098.1	0.0	1	764	1	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.41e-171	3	755	36	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	5.74e-167	14	763	14	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.21e-166	14	763	14	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	3.16e-157	14	763	13	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	3.24e-148	42	757	19	727	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.44e-153	89	763	48	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	3.35e-150	14	749	38	751	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.72e-148	14	749	38	751	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	6.63e-132	3	754	29	746	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.01e-103	10	749	35	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_01975.