CAZyme Information: MGYG000001525_02285

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_02285
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000001525_19|CGC1	81328.57	6.6437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 1424; End: 3682 Strand: +

Full Sequence      

MKTKGMMILGAVLGSFLISAGGAAAAERFSDLQHVKWAEDRINYMADRGTVAGYGDGKFA
PDKPVTRAQAVTFMVRELYPEQLQSGAVRTSYSDVPTTHPFYREISVAEKNGLASGFPDG
TFHPDTAMSRAETAAFLTRAYALVSGKQPVNLTDVHDHWAAAPIHVMSSNGLLGGYPDGT
YRPDRTVTRAEFSVFLSRVIRFERQTAIVAQDWDKLISYMTISEQVGQMLMPDIRQWNGQ
ATTTVNEGLKDRIHGQDLGGLILFDKNIIDARQIVKLTHDIQQEAGDIPLFLGIDQEGGV
IKRIPGGTNLPGQMALGATGDAALAEAAGKLTGEELKALGLQVNFAPVLDVNSNPDNPII
GMRSFSSDADLVSRLGLATIQGLRQSGVIAAVKHFPGHGDTTVDSHLGLPVLTHSRDRLD
AVELKPFRAAIDGGVEMIMTAHIAFPSVDHELVTSLKDGSSVPIPATLSKKVLTGLLREE
LGYQGIIISDAFTMNGIAEHFGENQAVERAVNAGVDIILMPQDPAAAHQTLVQAVKKGTI
PAETIHESVKRILELKSKYGLFDQKASLTQKLGALKTIGSEAHRAVGREIAERAATVLAS
RDGAQPDPIRSGDRVVIAAVDQEQAEQLQRQLAKASSNLSLTTEISIFGQGKISETLQRM
EKADYVILASYQFRNVASQFGWAEVQTMINDLNKQNTRYTLLSLGNPYEMIYVQNIRSGL
AVYGKQEPNTHAGIQVLLGQLKANGRLPVSTK

Enzyme Prediction     

No EC number prediction in MGYG000001525_02285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	283	520	3.3e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.19e-104	220	618	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.50e-98	221	555	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.76e-55	259	531	27	290	beta-hexosaminidase; Provisional
PRK15098	PRK15098	6.27e-20	214	606	39	406	beta-glucosidase BglX.
NF033190	inl_like_NEAT_1	1.32e-18	5	201	556	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79125.1	0.0	1	751	1	752
QLG40145.1	0.0	1	752	1	754
QZN74270.1	0.0	1	751	1	752
APO45876.1	0.0	1	751	1	752
AZN41244.1	0.0	1	749	1	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	7.95e-139	189	749	2	615	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.85e-138	210	749	6	589	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	7.45e-138	210	749	36	619	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	2.19e-90	220	748	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.05e-80	222	750	9	526	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.36e-138	189	749	2	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.52e-81	220	750	16	595	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	2.10e-48	255	749	54	553	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
Q1H075	4.02e-42	252	545	22	305	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
Q0AF74	1.68e-40	241	531	11	293	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000347	0.998957	0.000202	0.000170	0.000156	0.000139

TMHMM  Annotations     

start	end
7	26