CAZyme Information: MGYG000001525_03355

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_03355
• CAZy Family: GH32
• CAZyme Description: 5-dehydro-2-deoxygluconokinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
822	MGYG000001525_19|CGC16	91809.55	5.0294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 1136130; End: 1138598 Strand: -

Full Sequence      

MLDVIAIGEVLIDFTPAGRSTGGNEQFECNPGGAPANVAAALSRLGSKSALISKVGEDQF
GSLLHQTLQNAGVDVAGVSYTKEASTTLAFVHLDDHGDRSFSFIRKPGADTFLQSMDLPH
EKIVNSRILHYGTVSMTHEPARTATRTAVLQAKEAGVLLSFDPNIRFPLWESPEEAKQHI
LWGMKYADILKISEEELSFITGTHDIEEGSLKLAQQFEIALIVVTLAEKGCYYRIGSKDG
YVSGFQVKVVDTTGAGDAFLGCLLFKILEAGSPLKDLTPSQITNMLTFANAGGALVTTRK
GALRAMPTTEEIHQMLESNPQLKEEDLFRPGFHFSPPSHWLNDPNGLVYYEGSYHLFYQH
HPYGNQWGPMHWGHAVSKDLVHWEHLPIALFPDEHGAIFSGCCVVDWKNSSGLFEDSHGL
VAIFTHADTHPETGQPRQRQSLAYSSDKGLTWHKYEGNPVLAEEELVDFRDPKVFWHSES
ERWIMVLVAGDHVRFYQSQNLLKWSLSGVFGKEEGSHDGVWECPDLFELPIGDTGRSKWV
LIISIGDHPKGPEGSRTQYFIGEFDGKTFINDNSADHILWLDYGRDNYAGVTWSDLPEED
GRRVIIGWMSNWKYANETPTGAWRGAMTLPRVLSLTEQDGSVVLSQMPVREIEQLRKASL
RWEEITVTREAPFWQNVKEDLLEMEVDLDIRSGEEVLIRLKSSEKDEVIVGYDPGNQWLF
IDRTHSGVTDFHLSFASKHGAKMAAIDGKIQLHLWLDRNAVEVYGNQGLVVLTDQIFPKV
PLDQVEIITRSGEVVLDSVQIHTLKSVEIPYAFPKQVACQEG

Enzyme Prediction     

No EC number prediction in MGYG000001525_03355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	333	643	8.7e-105	0.9863481228668942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18622	GH32_Inu-like	1.02e-163	338	635	1	289	glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	4.49e-147	314	806	14	486	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	7.49e-145	333	768	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	1.33e-123	333	643	1	305	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
cd01167	bac_FRK	1.17e-109	4	302	2	294	Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS14150.1	0.0	1	810	1	809
QYK67444.1	0.0	1	810	1	809
AET57144.1	0.0	1	810	1	809
QSF46859.1	0.0	1	809	1	808
AIQ31424.1	0.0	1	818	1	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Y4W_A	2.57e-101	328	778	7	487	Crystalstructure of exo-inulinase from Aspergillus awamori in spacegroup P21 [Aspergillus awamori],1Y9G_A Crystal structure of exo-inulinase from Aspergillus awamori complexed with fructose [Aspergillus awamori],1Y9M_A Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P212121 [Aspergillus awamori]
3RWK_X	1.69e-87	320	804	20	513	Firstcrystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum],3SC7_X First crystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum]
3KF3_A	3.29e-77	329	804	10	507	ChainA, Invertase [Schwanniomyces occidentalis],3KF3_B Chain B, Invertase [Schwanniomyces occidentalis]
3KF5_A	3.55e-77	329	804	13	510	ChainA, Invertase [Schwanniomyces occidentalis],3KF5_B Chain B, Invertase [Schwanniomyces occidentalis]
3U75_A	4.59e-76	329	804	36	533	ChainA, Fructofuranosidase [Schwanniomyces occidentalis],3U75_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],3U75_C Chain C, Fructofuranosidase [Schwanniomyces occidentalis],3U75_D Chain D, Fructofuranosidase [Schwanniomyces occidentalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05656	5.93e-159	324	807	31	512	Levanase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacC PE=1 SV=1
O31411	1.81e-110	326	807	395	878	Levanase (Fragment) OS=Bacillus sp. (strain L7) OX=62626 PE=1 SV=2
Q96TU3	2.43e-100	328	778	26	506	Extracellular exo-inulinase inuE OS=Aspergillus awamori OX=105351 GN=inuE PE=1 SV=1
E1ABX2	1.31e-99	328	806	26	534	Extracellular exo-inulinase inuE OS=Aspergillus ficuum OX=5058 GN=exoI PE=1 SV=1
Q76HP6	1.31e-99	328	806	26	534	Extracellular exo-inulinase inuE OS=Aspergillus niger OX=5061 GN=inuE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_03355.