CAZyme Information: MGYG000001525_03962

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_03962
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001525_20|CGC8	40411.08	4.9599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 464332; End: 465411 Strand: -

Full Sequence      

MPETTNKVKGEEDGEMLKLKTTPSELKPVMQRVVEYTFGMDLTWDWPCGVAYYGISRAFE
ATGESAYVERMIQWCDEYLEAGLPVWTVNACAMGHMLLTLYEQTKEQKYLDLILSKIDYL
LNQAPRFGDRVLQHTVSAGNDFPEQCWADTLFMAAYFMLRTGIMLGEKPLIDDALHQFFG
HIHYLQSEDTGLWYHGYNHLNQDHMSGIYWGRANAWAAYTMSRAAKILPEAYLYPPMMHI
WSSLRDQLAALKKLQHEDGLWGTVLDYPDAYGEVSATAGISAAMLTQGNPLHAKYVQKAL
DGVLSNITEQGRVLNVSGGTAVMKDIEGYLQVDRKWAQGWGQGLTLALLAAVIENGQQA

Enzyme Prediction     

No EC number prediction in MGYG000001525_03962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	42	352	3.7e-77	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.36e-92	29	352	19	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.73e-78	36	346	19	333	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48636.1	7.95e-209	17	354	1	338
ACX67065.1	1.62e-205	17	354	3	341
QNK60304.1	1.55e-203	17	355	1	339
ANY76770.1	1.68e-202	17	354	3	341
QGG57461.1	5.78e-200	17	355	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	8.09e-40	44	355	65	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.34e-39	44	355	66	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.71e-38	44	349	47	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	3.03e-19	44	300	23	287	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.14e-110	16	355	1	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_03962.