CAZyme Information: MGYG000001525_04201

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_04201
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
187	MGYG000001525_20|CGC16	21856.16	9.7161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 720322; End: 720885 Strand: -

Full Sequence      

MRWLRKKRVLLLLFIGFTVLIFFNSAWLSLFYPIHYKEEIRQHAKNNGLDPFIVAAIIKV
ETNYKSGAESRKGALGIMQIMPDTAEWVISKAKLPDTTLEDIRNETETNIRIGTWYLKSL
SDQFDGNEIAMIAAYNAGPTNVKNWLKSGRWDGRLETAQNIPFGETRHYVQRVSHYYKQY
LKIYEEF

Enzyme Prediction     

No EC number prediction in MGYG000001525_04201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	181	2.2e-30	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.46e-77	33	178	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.33e-55	32	177	2	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.01e-40	51	178	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	1.02e-30	32	176	475	620	lytic murein transglycosylase; Provisional
COG0741	MltE	1.67e-30	36	187	139	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48080.1	3.92e-103	1	186	1	186
ANS73761.1	2.26e-102	1	187	1	187
AZS16481.1	1.19e-97	1	187	1	187
AWB44089.1	6.89e-97	1	187	1	187
ASA20339.1	8.50e-91	1	187	1	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	8.15e-25	28	176	441	588	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	8.40e-25	28	176	470	617	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	2.07e-24	28	176	441	588	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	2.07e-24	28	176	442	589	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	3.67e-24	29	173	409	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	8.76e-22	32	176	476	621	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	7.58e-21	32	176	476	621	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	7.58e-21	32	176	476	621	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	3.00e-17	25	176	415	568	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.04e-16	38	177	62	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.973421	0.004924	0.001949	0.000044	0.000021	0.019672

TMHMM  Annotations     

start	end
9	31