CAZyme Information: MGYG000001525_04722

Basic Information

• Species: Paenibacillus_A rubinfantis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A rubinfantis
• CAZyme ID: MGYG000001525_04722
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
699	MGYG000001525_20|CGC25	79074.79	5.1539

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001525	5369528	Isolate	not provided	not provided

• Gene Location: Start: 1291620; End: 1293719 Strand: -

Full Sequence      

MTTDGHITEKVRFWAETDRLKHFDNGLARLSYDLAGGTFTWTCREALVWQEIRSAFRWQG
REYNTGLYERHEMMGEPKELNDAFGQGLQVGIYHEKPGLPRVEQYFYLYDQQPFFLIQVV
VAGEAGLKLNRITVLQSAKLSIDHAPSRHEASGEDPLHALRIPYDNDKWVRYIAQPLPWE
TESYEAAALFYPGSRRGFVTGSVSHDVWKTGIRIRSEHAGKLDEFELYAGAAGVMTRDTQ
PHGYVHGPRVESPLVFAGYYEDYREGLEAYGRANAAVEPPLKWEGGVPFGWNSWSAAMST
LDYELYTSTSDFLKREMQPLGFESGETLYINFDAFWDRLTAEEMEDALGRVRENGHKPGT
YWTPFAFWGSPEQFSREVEGTGGKYTYGEILLRDAEGEIVADIAGGLAIDPTHPGALQRI
DWFTEKILREGFEYVKLDFMAHGALEGKHYDPVITTGIAAYRYGLSYLAAKLSPEAVGRP
FFINLSIAPLFPYAFAHSRRISCDVFGQIGDTEYLLNSLTYGWWMNDRLYRFNDPDHTVL
YKSFNQDETGWHEGRSRLTASVIAGTLLLLGDDFRKEGAAERAKAWLGNRAVMDVARLGQ
TFRPLEWGFHDRAADVFVLEAPASDANGGDALYMAVFNFDGTRGARKTVSLARAGLHPKL
LYRVDDLWEGTEQETAGELVVDLKPAEAKLFKLTQRTVI

Enzyme Prediction     

No EC number prediction in MGYG000001525_04722.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14792	GH27	2.23e-11	288	595	2	268	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	1.68e-05	626	693	12	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14791	GH36	0.002	391	588	104	295	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ40110.1	0.0	1	697	1	685
QOT11183.1	0.0	25	693	23	682
AVV57527.1	0.0	1	694	1	683
AYB43258.1	0.0	15	693	15	683
ANA78556.1	0.0	1	694	1	683

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001525_04722.