CAZyme Information: MGYG000001526_02034

Basic Information

• Species: Paenibacillus_A senegalimassiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A senegalimassiliensis
• CAZyme ID: MGYG000001526_02034
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000001526_14|CGC1	51218.41	4.5478

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001526	5059338	Isolate	not provided	not provided

• Gene Location: Start: 2290; End: 3693 Strand: -

Full Sequence      

MMQKRKGKISILAILALLITLFAPLPFDAQATQAATTLDVSENVTIAAYPAWDSNAVYVG
NDIVSYNGNDYRAKWWTQGDVPGESDVWELVPPSNGEYPVWSSGKAYVGNDIVSYNDQLY
KAKWWTLGEIPGIAAVWELIAGNPNPNPNPNPNPGGPDDPPISGDFKVVGYYPSWEPDKI
NTIQYQNLTHINYAFAIPTSDGALLPLENPSAATQIIQTAHSNGVKVLLAVGGWSYNGTP
LENTFMAATNSQQKIVQFGNAIIAMAKQYGFDGVDMDWEHPRSDGSSKQQYEGLMVYLGQ
ELKKDNMLLTSAVLSGVTPEGVIYWDAAAHTNAVINAVDWFNVMAYDGGDGDRHSSYDFA
VLSAKYWKETRNMPAGKVVLGVPFYGRPSWAPYRDILQANPNAYNTDISMINGMEAHYNG
IPTIERKTQYALDNLGGVMIWELTQDTTDSSKSLLQAIGNKVRAHSN

Enzyme Prediction     

No EC number prediction in MGYG000001526_02034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	167	451	5.6e-53	0.9493243243243243
CBM5	49	88	4.1e-18	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06545	GH18_3CO4_chitinase	8.04e-58	168	458	1	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
pfam00704	Glyco_hydro_18	9.44e-51	167	446	1	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.76e-47	167	446	1	334	Glyco_18 domain.
cd00598	GH18_chitinase-like	5.38e-39	168	446	1	210	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06548	GH18_chitinase	3.45e-35	168	446	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU18460.1	7.99e-149	29	463	60	442
QRP38084.1	4.56e-148	29	463	60	442
ASN97117.1	4.56e-148	29	463	60	442
QNM13846.1	5.50e-137	49	462	78	443
BCJ98260.1	6.26e-136	165	463	11	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	2.09e-34	167	461	18	304	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
3CO4_A	4.58e-23	168	454	6	292	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
5Y29_A	1.58e-19	162	387	3	253	Crystalstructure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.77e-19	162	387	3	253	Crystalstructure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
5XWQ_A	3.92e-19	167	458	3	365	Crystalstructure of chitinase (RmChi1) from Rhizomucor miehei (sp p32 2 1, MR) [Rhizomucor miehei],5YUQ_A Chain A, Chintase [Rhizomucor miehei],5YUQ_B Chain B, Chintase [Rhizomucor miehei],7FBT_A Chain A, Chitinase [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q13231	5.45e-17	167	387	23	269	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q95M17	4.23e-16	162	386	18	268	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
P20533	8.92e-16	166	457	44	449	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A0A1B1J8Z2	9.14e-16	160	387	49	290	Class V chitinase CHIT5 OS=Lotus japonicus OX=34305 GN=CHIT5 PE=1 SV=2
Q91XA9	7.54e-15	162	446	18	365	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.999043	0.000200	0.000189	0.000150	0.000137

TMHMM  Annotations     

start	end
7	29