CAZyme Information: MGYG000001526_02389

Basic Information

• Species: Paenibacillus_A senegalimassiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A senegalimassiliensis
• CAZyme ID: MGYG000001526_02389
• CAZy Family: PL3
• CAZyme Description: Pectate lyase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000001526_14|CGC4	23341.27	9.8805

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001526	5059338	Isolate	not provided	not provided

• Gene Location: Start: 407057; End: 407728 Strand: -

Full Sequence      

MKKVLGIILSGVLLVALSGVTQVDAASPIVVNKTIVVKAGETFDGKGQTYVADPKALGDG
SQAEGQKPIFKLENNATLKNVNIGAPGADGVHVYGNGTITNVTWLDVGEDALTLKSSGTV
NISGGGAYKAYDKVFQANAAGTINIKNFKAKDIGKLARQNGGTSYKVNFTLDNSDISDVK
DSIFRTDSKSSTAKITNTRYHDVPTLFKGFASGNTSQSGNTKY

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	29	200	3.7e-76	0.9826589595375722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03211	Pectate_lyase	2.19e-74	25	214	7	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA26418.1	3.48e-120	1	223	3	227
AIQ31263.1	4.72e-118	1	223	3	227
AIQ42789.1	4.72e-118	1	223	3	227
AIQ58796.1	6.70e-118	1	223	3	227
QUL58344.1	3.91e-116	22	223	12	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	7.55e-100	27	223	1	197	CrystalStructure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.31e-56	29	208	8	185	Theliganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.35e-56	29	208	9	186	Thecrystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z05_A	1.39e-55	29	208	17	194	C.bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]
4Z03_A	1.39e-55	29	208	17	194	C.bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3JTC1	2.80e-105	1	223	1	222	Pectate lyase A OS=Paenibacillus amylolyticus OX=1451 GN=pelA PE=1 SV=1
Q9X6Z2	5.64e-105	1	223	1	222	Pectate lyase A OS=Paenibacillus barcinonensis OX=198119 GN=pelA PE=1 SV=1
Q65EF5	1.67e-65	1	203	1	203	Pectate lyase C OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=pelC PE=3 SV=2
O34310	2.88e-61	26	203	27	203	Pectate lyase C OS=Bacillus subtilis (strain 168) OX=224308 GN=pelC PE=1 SV=1
A1DBJ7	3.00e-23	42	206	54	210	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999070	0.000193	0.000170	0.000160	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001526_02389.