CAZyme Information: MGYG000001526_02995

Basic Information

• Species: Paenibacillus_A senegalimassiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A senegalimassiliensis
• CAZyme ID: MGYG000001526_02995
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000001526_15|CGC5	39151.93	5.1533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001526	5059338	Isolate	not provided	not provided

• Gene Location: Start: 148229; End: 149278 Strand: +

Full Sequence      

MKLWVGKHPGCDTSTIQAAVDLAERQPVDRTAIIYIHPGVYEEMVRIDRSNLALIGLGEV
VIRMNRHATELNEAGEEIGTFATPTLFLGGSRLVLEHLTIENTAGPGEQAGQALAVYAHC
DLAVFRHCRLIGQQDTLFTGPLPPYPLTRPAFGGFPLREHHQQYRQLYDQCRIEGNIDFI
FGGATAYFEDCEIHSLARMNPLSPGYITAASTAPEQAAGYVFSRCRLSAEPEVGKGSVFL
GRPWREHAATSFVNCELGEHIHRQGWDPWDDSGREKTVRYGEYGLGTRAIELRVSRVPWA
ACCEHGEEAWSRQEVFGEAEEHFFYRILRLSEGGWEFENDNSEPDFARL

Enzyme Prediction     

No EC number prediction in MGYG000001526_02995.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	5	302	4.5e-78	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.38e-64	9	284	90	373	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02708	PLN02708	1.27e-55	5	301	245	527	Probable pectinesterase/pectinesterase inhibitor
pfam01095	Pectinesterase	8.54e-54	5	300	4	275	Pectinesterase.
PLN02671	PLN02671	2.37e-46	5	300	63	334	pectinesterase
PLN02682	PLN02682	2.09e-40	3	300	71	344	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR46794.1	5.97e-134	5	316	3	310
AUO08110.1	2.51e-133	5	316	3	311
AZH30267.1	5.05e-133	5	316	3	311
QDA28576.1	5.05e-133	5	316	3	311
CCI70060.1	1.44e-132	5	316	3	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.07e-30	12	299	14	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.11e-29	12	299	18	281	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	2.13e-26	10	276	41	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	8.59e-23	12	293	14	317	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	1.02e-20	31	287	35	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7Q7	1.18e-45	11	301	299	576	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9FM79	1.12e-42	5	318	84	375	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9LXD9	7.28e-40	5	301	243	525	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
O04887	1.79e-34	12	299	212	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
O49298	9.94e-34	3	299	251	516	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001526_02995.