CAZyme Information: MGYG000001526_03039

Basic Information

• Species: Paenibacillus_A senegalimassiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A senegalimassiliensis
• CAZyme ID: MGYG000001526_03039
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		23469.49	7.3532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001526	5059338	Isolate	not provided	not provided

• Gene Location: Start: 201422; End: 202075 Strand: +

Full Sequence      

MSTTEIHLIDGAGNDFYFPVNPDEITISRSKGLETVSILSLGEYDVSGGEKVKEIAFSSF
FPVAYDPGYCNYENLPDPQEAMNHLTTLMNSKSPVRLIISGTAVNVLVTLAAHGSSFRGG
EPGEVYFDLTARSWREMKVHTSAAASASGAAAGKPNRPDTKQPSKTYVVKAGDSLSKIAK
LELGDSAKWRQIYSANQQTIGKDPNRIKPGQKLVMPQ

Enzyme Prediction     

No EC number prediction in MGYG000001526_03039.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	2.47e-13	163	217	94	147	LysM domain/BON superfamily protein; Provisional
COG1652	XkdP	7.24e-13	12	217	72	263	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	5.76e-10	165	214	1	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.45e-07	166	214	1	43	Lysin motif.
NF033163	lipo_LipL71	3.41e-07	165	216	405	460	lipoprotein LipL71. Members of this family are lipoprotein LipL71, also known as LruA, as described in Leptospira interrogans but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS14242.1	2.95e-111	5	216	2	210
AZS15369.1	8.99e-98	5	216	2	215
AJE50689.1	3.09e-88	5	215	2	212
QOH60927.1	3.09e-88	5	215	2	212
AWB45319.1	9.15e-88	8	216	5	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	2.17e-29	19	217	20	219	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	4.20e-25	19	217	20	219	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001526_03039.