CAZyme Information: MGYG000001527_01757

Basic Information

• Species: Fournierella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Fournierella; Fournierella massiliensis
• CAZyme ID: MGYG000001527_01757
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000001527_16|CGC2	83900.6	5.3103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001527	3828237	Isolate	not provided	not provided

• Gene Location: Start: 318165; End: 320417 Strand: -

Full Sequence      

MGIQFDAAARTFTLSTRSTTYQMGLDHLDRLLHLYYGPAIGQGDLAAMYPPADRGFSPNH
NADRERRGISPDVLPQEYTGCNTGDFRLSCLVVREENGAAGAEWHYASHSIQKGKYALTG
LPAAHDEENEAESLCIRMEDSVTGLALELLYGVFEAQDIITRAARLVNDGSQTLRLEKAA
SMCLDLPFGRWDMIHFHGRHAMERRMERTPLMNAIQTVSSTRGASSHHHNPFVILCDRKA
TEEHGLCYGVMPVYSGSHRTDVEVDQNGLTRIVSGIHDERFSWQLAPGEAFIAPEVILAC
TENGLTALSQQYHRFIRHNVCRGEFRFARRPVLINNWEATYFDFDSDAIVRIAEKAAALG
VEMLVLDDGWFGKRNDDNSGLGDWFVNENKLPGGLSPLIDRVNALGMKFGIWVEPEMVSE
DSDLYRAHPDWALTLPGRAPVMSRNQLVLDMGRDDVVDYLTERLTDLLANNNIAYVKWDM
NRNMTDVYSRVLPADRQGEAAHRYMLGVYKLLETLTTRFPHVLFEGCAGGGGRFDAGMLA
YFTQIWCSDDTDAIERLVIQHGTSFGYPVSSMGAHVSACPNHQTGRTTPLWTRAVAAMAG
TFGYELDLNKLSDEEAAQVKEQIAFFDKHYQLIQNGLYYRLTDPTEEERYAAWQFVDEEQ
GETLVNLVLTHPEANARPLHLWLRGLAPDALYRVESLDIHGCHAAPQAGLDLAMEGVGKV
YSGSTLMRAGYTLPQLAGDYPSVQMYVKRV

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	12	731	1.1e-269	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	67	750	48	687	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	291	636	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	4.15e-147	329	628	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	6.16e-106	35	286	7	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	1.95e-20	650	746	1	77	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO99394.1	0.0	1	749	1	746
QIA42213.1	0.0	1	749	1	746
AWY99332.1	5.01e-292	12	747	10	723
QFJ54542.1	3.96e-287	1	749	1	729
BCN32673.1	7.21e-278	1	745	1	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	2.01e-258	1	744	1	714	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	5.06e-238	1	750	1	727	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.04e-237	1	750	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	1.88e-235	1	750	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	2.66e-235	1	750	1	727	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	1.49e-254	1	744	1	714	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	1.12e-236	1	750	1	727	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	2.55e-209	3	750	6	731	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.05e-208	3	750	4	730	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
Q0CEF5	3.89e-178	71	695	66	692	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001527_01757.