CAZyme Information: MGYG000001527_02314

Basic Information

• Species: Fournierella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Fournierella; Fournierella massiliensis
• CAZyme ID: MGYG000001527_02314
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625	MGYG000001527_18|CGC1	69889.19	6.7796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001527	3828237	Isolate	not provided	not provided

• Gene Location: Start: 11183; End: 13060 Strand: +

Full Sequence      

MANEKNNQPLPADVAQKDSVGGMAKRLLDPAHVKQLAGWCARVAREEGGQALWREISFRV
NLALHRDTWQYRADLPTRRMLKRQRAEGVPGGPKISVVVPLYNTPLPFLKQMIESVTGQS
YPNWQLVLADASDEAHAQVGAVARRYAAKDSRITYKKLAENQGIAGNTNQGFALATGDWL
TLLDHDDVLYRNALYEVAKAAVEGADFVYSDEIVLSADLKHLVDYHFKPDFEPDYLRGCN
YITHLAAFSRGLFEATGGGERAEYDGSQDFELILRLTEKAKKIVHIPYALYIWRSHAAST
ASSMDAKPYALAAGERALNDHLKRVGLAGEATRIPGCPGAYRVRYELTGTPLISIMIPNK
DHVEDLSRCLESLYKYAGYDRFEVIVIENNSTDSATFAYYKKAKQQFANLQVVQYEGGFN
FSAINNFGRKFAKGEQLLLLNNDVELLSEGFLAEMLMYSQRPDVGCVGAKLYFPDDTIQH
AGVFLGINGTAGHSHKSHPRASAGDLYRLATPQDLMAVTGACLMVKADLYDACGGLDEEK
FAVAYNDIDLCLKLWQQGLLNVFTPFAEAYHHESKSRGLDTLSENAKRYEREKANFIEKY
TPLIQKGDPYYNRHFNLLFENYGLK

Enzyme Prediction     

No EC number prediction in MGYG000001527_02314.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	96	209	6.6e-25	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.01e-85	93	294	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.26e-40	355	573	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	8.61e-28	349	619	1	262	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.43e-23	96	253	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.51e-22	96	300	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81613.1	1.88e-184	90	625	267	803
CBK99960.1	2.66e-184	80	625	258	803
QUO22278.1	2.76e-183	82	625	85	629
QUC66692.1	1.20e-180	94	625	417	946
AXB29591.1	1.90e-180	80	623	254	797

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.84e-07	92	206	4	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.06e-121	92	612	365	885	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.01e-89	93	625	319	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q0P9C6	5.26e-09	93	214	2	121	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
P71054	1.29e-08	92	194	4	104	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
A0A0H2UR96	3.76e-08	95	194	5	101	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001527_02314.