CAZyme Information: MGYG000001529_01036

Basic Information

• Species: Gabonibacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter massiliensis
• CAZyme ID: MGYG000001529_01036
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000001529_7|CGC3	88514.16	8.6153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001529	3396579	Isolate	not provided	not provided

• Gene Location: Start: 217573; End: 219933 Strand: +

Full Sequence      

MKSRKLFRITWILIVVIGGAFVAFWCLFLPDPLFTVPYSTVVLDREGEVMGITVADDGQY
RIRGKSSISEKYVTALLSFEDNCFLSHRGVDPFAIARALWLNIKNGSIVSGGSTLTMQVV
RLARRNPPRTVPEKIIEMLLAVRLEQSYTKWEILNLYAAHAPFGSNIVGLEAAALKYFNR
KPNELSWAEACLLAVLPNAPALIFPGKNMPLLKKKRDDLLRRLYRKGNLDREDLELAIAE
PLPEKIYNTECIVPHVLTKAYKYRRGEVSRSTIDAGLQGRVNEIVKRHIAILKHNHIYNA
AVLVGHIPSGEVRAYVGNSPKVRENGGNQVDIITSNRSSGSILKPALYALMQYSGDILPK
TLLSDIPSRFGGYVPSNFNKEFQGVVPADQALAMSLNIPFVRLLRGYGVEHFYDNLKRMG
ITTLYREPGHYGLSLILGGAECSLWDICNLYGGMASILHHYNADDGSYYTGEFARLHLWS
DRPPVQKEGRCEVLNAASVWLTFQALQHVERPDMEVGWKNFASSMALAWKTGTSFGFRDA
WAVGVTPDYVVGVWVGNADGEGRAGLIGVRTAAPVLFEVAALLRSSARFYKPLEEMMPVV
TCRKSGYRASDVCPEVDTVWINENGMKTVLCPYHRLIHLDRTGTFRVDADCEPVYRMKTV
PWFVLSPAQEWYYSQTHADYLRMPPKRGDCKSEDEMMEMIYPQKGLRVFIPKDLGGKSKG
VVFEIAHREPSMKVYWHIDDEYVGMTRNQHQIEINVTPGYHVLYLVDAVGNTLRQPFYVV
KGDENL

Enzyme Prediction     

No EC number prediction in MGYG000001529_01036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	65	223	1.3e-46	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02073	PBP_1c	0.0	30	772	2	719	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	1.61e-173	8	779	3	731	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	3.37e-111	1	780	4	772	penicillin-binding protein 1C; Provisional
COG0744	MrcB	1.44e-94	6	578	18	591	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	7.81e-91	68	575	10	520	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS31892.1	0.0	17	785	6	779
QRO51978.1	0.0	20	785	13	779
SNV33934.1	0.0	24	780	28	793
ADY32603.1	0.0	24	780	28	793
BAX81168.1	2.30e-259	22	785	26	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UDF_A	3.86e-29	68	435	47	518	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
2OQO_A	1.08e-28	68	238	28	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.26e-28	66	556	45	694	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3NB6_A	3.72e-28	68	238	28	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	1.18e-27	65	561	161	672	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	6.72e-90	30	777	33	767	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
O66874	4.33e-39	29	621	30	707	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9KUC0	5.88e-38	43	561	162	693	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
P38050	2.34e-37	39	556	48	569	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P57296	5.19e-34	65	557	159	664	Penicillin-binding protein 1B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999790	0.000180	0.000039	0.000001	0.000000	0.000023

TMHMM  Annotations     

start	end
7	29