CAZyme Information: MGYG000001529_01701

Basic Information

• Species: Gabonibacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter massiliensis
• CAZyme ID: MGYG000001529_01701
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001529_7|CGC4	35547.41	8.9889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001529	3396579	Isolate	not provided	not provided

• Gene Location: Start: 978049; End: 978975 Strand: +

Full Sequence      

MKKETIIKILFLIVLLDTAAVIYLIYRPVTLEIQHVSKVVPMLKPSDIYCPETFDLAGEY
VPLKRTDIAEAFRKELIVNTYLHSHTIQVLKNVSRYFPIIEPILEEEGIPDDFKYLAVIE
SSLNPLAVSPAGAVGLWQFMSGTAKELGMEVNKIVDERYHIEKSTRAACAYLKKAKEKFG
TWVMAAASYNAGMNMLTRQINLQKENNYYDLLLGEETGRYVFRIMAMKQIIENPHLYDFH
VSEKYEVEKCEEVKVNKNIKDLAHFANTHGISYKTLKRFNPWLRANTLHASGKKSYYIAI
PRQPEKYR

Enzyme Prediction     

No EC number prediction in MGYG000001529_01701.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	96	238	2.9e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.14e-63	104	229	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.38e-26	99	211	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	4.21e-25	68	302	80	312	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	2.94e-22	116	226	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.81e-20	96	226	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51442.1	1.74e-140	1	308	1	308
AZS32129.1	3.50e-140	1	308	1	308
ADY32428.1	2.74e-116	46	308	49	311
SNV32652.1	2.74e-116	46	308	49	311
AHW59007.1	2.48e-100	42	301	42	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	4.51e-24	68	303	77	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	4.51e-24	68	303	77	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
O31608	1.40e-06	120	227	85	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.856019	0.140612	0.001217	0.000315	0.000220	0.001634

TMHMM  Annotations     

start	end
7	26