CAZyme Information: MGYG000001529_02700

Basic Information

• Species: Gabonibacter massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Gabonibacter; Gabonibacter massiliensis
• CAZyme ID: MGYG000001529_02700
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		36571.84	9.7108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001529	3396579	Isolate	not provided	not provided

• Gene Location: Start: 2112702; End: 2113658 Strand: +

Full Sequence      

MKNIIIRMPNFIGDSINTLPAIDLLKQEYPDSRITLLGLSFIKDIFEHDPRIDDFICFEK
GRKNYLTFVKRIYQGKYDLGILFTNTFISVFIFKLALVKCLIGYKNEGRGFLLDFKMPLN
RNVHYINRYAMLVNKYFNNKYIYLPPLRLFYKQEKTFYFPDNKQVIGLYLGGINKKYRRY
PESLSLELLKLLNGYNLVLIGDRNDAGIHASYLKRVKLDSVINLTGKTSVGEFVTTIANL
DALITIDSSAMHIAAAVHTKFVALLGLSTSPTSTILPKVDFGIALKVENNMINEEDYIRN
ITPRMIVDHVELLLNRGD

Enzyme Prediction     

No EC number prediction in MGYG000001529_02700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	67	272	1.4e-28	0.8266666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.50e-37	3	274	1	230	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.16e-32	1	315	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	1.81e-22	3	274	1	285	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	1.31e-13	68	274	4	217	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10916	PRK10916	4.97e-11	1	274	1	295	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51372.1	6.88e-143	1	316	1	316
AZS29611.1	3.69e-142	1	316	1	316
SNV46455.1	2.86e-118	1	314	1	320
ADY34502.1	2.86e-118	1	314	1	320
BAX78589.1	2.72e-79	2	311	12	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	2.58e-09	9	314	8	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	2.51e-15	3	314	2	344	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37421	7.52e-10	9	315	8	344	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P37692	1.35e-09	9	314	8	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
79	98