CAZyme Information: MGYG000001530_01245

Basic Information

• Species: Anaerococcus rubeinfantis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus rubeinfantis
• CAZyme ID: MGYG000001530_01245
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000001530_3|CGC7	25096.94	9.086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001530	1928931	Isolate	not provided	not provided

• Gene Location: Start: 1058781; End: 1059437 Strand: -

Full Sequence      

MKALKNIFKIIGIIVLAMVMVVIISFSIVAYQTSRQKIAYQDEIKKYSEKYNVDPLLVAS
IIKVESDYDNEAHSNQNAKGLMQLLDSSAKHSAEIIGEEYYPDKLKDVDYNLNLGVGYFN
YLNKYYNNTDLALAAYNGGIGNVDKWLADKKIDRHDPDPTKIPTEETRQYVIKINSNYDL
MKVFYDEGLPSKNDLKDRKKLAIKNYKKFVKKILFDVL

Enzyme Prediction     

No EC number prediction in MGYG000001530_01245.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	181	3.9e-24	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.79e-55	38	180	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.21e-38	39	178	5	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	7.29e-31	55	178	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.58e-28	3	191	104	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	8.40e-24	44	148	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN55587.1	3.46e-135	1	218	1	218
QQB62557.1	8.14e-134	1	218	1	218
ACV29351.1	3.28e-89	1	217	1	217
QQK07141.1	2.67e-44	1	187	1	184
BAG07763.1	2.13e-43	19	214	16	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.80e-13	40	177	416	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.80e-13	40	177	420	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.82e-13	40	177	430	565	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	3.82e-13	40	177	426	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	3.84e-13	40	177	436	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.20e-13	44	178	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.41e-12	40	178	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.41e-12	40	178	1422	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P44888	7.04e-12	31	194	419	580	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
A9MQR3	3.75e-10	24	176	177	352	Membrane-bound lytic murein transglycosylase C OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.888022	0.052508	0.004136	0.000421	0.000232	0.054695

TMHMM  Annotations     

start	end
7	29