CAZyme Information: MGYG000001530_01487

Basic Information

• Species: Anaerococcus rubeinfantis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus rubeinfantis
• CAZyme ID: MGYG000001530_01487
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000001530_3|CGC9	55221.49	6.1557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001530	1928931	Isolate	not provided	not provided

• Gene Location: Start: 1330801; End: 1332216 Strand: -

Full Sequence      

MKIEEYKSLIKKAENSKNSHSLDPYRLNYHLMPKVGGLGDPNGLCQVKGTYHLGYIYSPI
KFELEGRSPCFWKQYTTKDFINYEDQEIFIYPDSQRDRDGVYSGSMIYENNKFYAYYTGN
VRHEGNHDYITSGREQNIMRVESEDGINFENKTLLMVNEDFPKNLSQHVRDPQVFKYDNS
YYMIIGARSLDDEGCAIVYKTEDLKNFKEINILQTDEKFGYMWECPDLIELNGKSFLIAC
PQGIDHEKFHFQNDHQCGAFLIDGDFRKNNKIKSFQEFDYGFDFYAARTLFDEKGRRILI
GWMGMPESSYALTPTSKNGWDQCLSMPRVLIEKDKHIYQKPLEEFKNLRKSHKNFEDNIF
ENSLTFEMKINLKKEEDLLIKLRKDCSLKYDSNRKILTLDMGTCGDGRNTRKMKLGSLSN
LRIFSDTSSLEIFVNDGYATMSTRIFDLESKVQVQTKNALIDFYELGEFKF

Enzyme Prediction     

No EC number prediction in MGYG000001530_01487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	341	2.8e-81	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	4.47e-133	36	334	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.36e-124	10	446	1	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	7.43e-114	1	446	3	458	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.50e-91	30	341	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.06e-91	30	437	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATV62505.1	2.34e-139	4	470	4	461
ATV34602.1	2.34e-139	4	470	4	461
QQQ86052.1	5.58e-139	1	446	1	448
QNM14308.1	1.05e-138	5	470	5	475
QEK20327.1	4.50e-138	1	446	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	1.01e-53	24	454	31	470	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	5.53e-50	29	451	29	463	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.73e-47	25	446	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.74e-46	25	446	48	460	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	2.29e-34	25	466	2	427	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	7.44e-83	10	454	16	461	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	7.17e-76	25	456	33	473	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	1.05e-66	28	446	39	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
A1STJ9	1.85e-62	25	454	95	522	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
P40714	1.29e-59	28	446	27	449	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001530_01487.