CAZyme Information: MGYG000001531_00161

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_00161
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001531_3|CGC1	45403.4	4.7243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 85774; End: 86928 Strand: -

Full Sequence      

MQAIHIKLGKAVIMENREIINAYIDKWIEDYNSRQRAVWNYEDGCVMLGAQYLYEATGDE
KYINCIRTFMDRYIQEDGTIRYYVPEDYNLDKVNNGRVLYFLYDKTGEEKYKTALDHIRG
QLETHPRTDCGSFWHKQIYPYQIWLDGLYMGQPLYLEYEKRFNGGERYNDITGQFLNARK
YLFDEEKKLYYHAYDEKRQMIWADKTTGCSHNFWLRSIGWYLMALIDCCGLIPEESFEHL
STYKRLFKEALAGIMQYQDEKTKLFYQLVDMPELEGNYLETSGSAMIAYAILKGCRLGIL
QEEKWRRRGEEIFDGLEREKLQQDEDGWHLTGICLVAGLGPKDERDGSVEYYLSEPVVSD
EEKGVGVFMMAYGEYLKLEKQDEA

Enzyme Prediction     

No EC number prediction in MGYG000001531_00161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	377	1.1e-105	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.86e-99	28	379	23	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.56e-77	15	378	5	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93648.1	2.48e-152	16	378	2	364
QHQ62178.1	3.45e-148	23	382	11	369
BCJ96410.1	1.72e-130	16	379	2	365
QTQ12711.1	6.19e-126	19	376	2	357
QTQ13070.1	6.19e-126	19	376	2	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.59e-105	39	375	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.46e-68	39	374	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.30e-67	39	374	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	1.86e-09	39	303	47	308	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.99e-67	39	374	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.86e-44	150	378	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.86e-44	150	378	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	9.73e-21	11	297	2	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001531_00161.