CAZyme Information: MGYG000001531_02097

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_02097
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000001531_8|CGC3	37187.73	4.9745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 587189; End: 588178 Strand: +

Full Sequence      

MTEKKPFTLVVAKDGTGDYSTVTEALAALGEEGEPALIYIKKGVYKERLTIRRPFVTFEG
EDMNETVITYNLGAKMEMEDGSRRGTFRSYSVLIDTHDFTARNLTFENSAGLGALVGQAL
ALYVDGDRILFDRCRMLASQDTIFTGPLPPKEIEPNGFIGPKQYAPRINGRHYYKDCFIR
GDIDFIFGSATAYFENCELYSQDIGREINGYVTAASTPEGQEYGYVFEGCHFTGNCPPRS
VYLGRPWRNFAKTVLLHCRMEEHIRREGWHDWGKREAHDTLYFAEAGSTGPGAVPEERPE
WVRILSEDELEPYSRERVLGGNDGWMSGR

Enzyme Prediction     

No EC number prediction in MGYG000001531_02097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	9	319	7.9e-95	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.93e-83	6	322	80	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.31e-74	10	322	3	298	Pectinesterase.
PLN02773	PLN02773	1.49e-65	9	311	7	288	pectinesterase
PLN02432	PLN02432	2.31e-62	9	326	13	292	putative pectinesterase
PLN02682	PLN02682	1.51e-58	7	313	69	355	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU50094.1	1.35e-160	3	328	11	349
QQR01004.1	1.35e-160	3	328	11	349
QIX89293.1	1.28e-158	3	328	11	349
QRP39805.1	8.84e-157	9	328	18	350
ASN95501.1	8.84e-157	9	328	18	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.52e-44	9	326	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.87e-41	10	326	6	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.87e-36	7	320	4	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	3.14e-35	7	314	31	353	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1QJV_A	3.01e-30	7	320	4	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.08e-57	11	309	9	286	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	8.11e-51	10	326	259	557	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43143	1.03e-46	9	327	273	573	Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum OX=4081 GN=PMEU1 PE=2 SV=1
Q9FM79	2.04e-46	9	326	82	378	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	2.32e-45	7	326	83	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001531_02097.