CAZyme Information: MGYG000001531_02868

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_02868
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	MGYG000001531_8|CGC11	65038.15	5.2487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 1432530; End: 1434272 Strand: -

Full Sequence      

MVDLKQKPFYLSDEDIRWVEETIASMTDEEKIGQLFIMLDRKKDFDETKEIFDRFHIGGC
RYSNEPAEKIYEQNRFYQEHSKIPVLIACNCDNGGDGACGGGTYVATAAACGATDDDSTA
YSVGYVSGREAAAVGCNWDFGPVCDLLYNWRNTIVNTRAYGKDPELVIKNAKAYVRGVRE
SGLAVCCKHFPGDGIEELDQHLVMGVNTMECDEWDSTFGHVYKEMIDSGIQSIMAGHIAL
PEYSRKLRPGIKDEDIMPATLAPELITDLLRGKLGFNGLVLTDASHMAGMTAAMPRSQQV
PGAIAAGCDMFLFFNDIEEDFGYMMDGYRNGIITEERLTDALRRILGLKASLKLHEKKKK
GTLIPEKEGLSVVGCAEHLAMAAEAAKKSITLVKDTQHNLPVTPKTHKRAYAFVISSPPI
SRKNQHDPVKQLVKEEMERFGYETTMHESYYDLVLDDGITKETELRSVIIGKVEEFKKKY
DVVFVFINMKGYAQANNVRLEWSIGHSTEIPWYVKELPTIFISLNYTNHLLDVPMAKTFI
NAYAPTREVIRQTIEKAAGEAAFEGTCNDNVFCGRWDTRL

Enzyme Prediction     

No EC number prediction in MGYG000001531_02868.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	312	1.8e-51	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	9.35e-65	26	412	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.57e-55	27	348	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.84e-27	120	316	99	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.37e-12	6	401	26	406	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM59112.1	1.55e-257	2	580	4	584
QCX33673.1	2.91e-253	1	579	3	565
BCJ94222.1	9.80e-243	2	579	3	578
AQM60421.1	3.21e-240	1	580	1	565
ADQ14511.1	3.16e-236	1	579	1	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.11e-131	4	580	6	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	4.09e-39	46	409	75	454	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.49e-38	46	409	49	428	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.97e-38	46	409	79	458	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	8.18e-33	25	395	10	378	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	9.77e-139	1	580	1	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	2.24e-38	46	409	75	454	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q7NWB7	2.81e-27	120	319	103	290	Beta-hexosaminidase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=nagZ PE=3 SV=1
Q2Y863	2.02e-24	120	318	101	287	Beta-hexosaminidase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71) OX=323848 GN=nagZ PE=3 SV=1
Q31G32	4.19e-24	120	316	109	293	Beta-hexosaminidase OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001531_02868.