CAZyme Information: MGYG000001531_03128

Basic Information

• Species: Enterocloster sp001517625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp001517625
• CAZyme ID: MGYG000001531_03128
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		48603.32	8.8615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001531	3412690	Isolate	not provided	not provided

• Gene Location: Start: 1682682; End: 1683926 Strand: -

Full Sequence      

MNTKRKILNFIRIFRPLYVPISNFIRRKFGTQGYVFAICKFIRRLPNAYFRGYVNNYRNP
VEHDEDKKPKHTIMNMQVHVLGNKNKGKVIMLLENQSHHAGFCALWVYFLNRLSFSDRHG
FYHVIDWNESEFYQEDHPVNGSTSIFEYYFEQPSGISLEDARKSSFVVYDWNNPEFGYND
TFHVGDTNDYKFTAKDIEQFAKIQRKYIHLHADIEKSIKEQIQKLFRGSNNVLGVHARGA
DTKIGYKGHPTIVTSEDYIDETQKMMNKVKADFIFLATDDQEMLDQFKAAFGDKLIYYDD
VIRSTGTVMNCFIEKERENHHYLLGLEIIRDVYTLAACNGFVCGMSYVSFIVQILKRANG
QKFTSFYRIFKGIQENGVDLKDANARKKISEKWKRELKMDNDEPLTSDIHSEKK

Enzyme Prediction     

No EC number prediction in MGYG000001531_03128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	197	346	5.5e-16	0.44025157232704404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11296	O-FucT_like	3.66e-12	205	361	46	206	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11548	NodZ_like	5.62e-06	141	339	93	263	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11300	Fut8_like	2.70e-05	197	346	155	297	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11302	O-FucT-1	2.46e-04	206	292	180	291	GDP-fucose protein O-fucosyltransferase 1. The protein O-fucosyltransferase 1 (Ofut1 or O-FucT-1) adds O-fucose to EGF (epidermal growth factor-like) repeats. The O-fucsosylation of the Notch receptor signaling protein is dependent on this enzyme, which requires GDP-fucose as a substrate. O-fucose residues added to the target of O-FucT-1 may be further elongated by other glycosyltransferases. On top of O-fucosylation, O-FucT-1 may have other functions such as the regulation of the Notch receptor exit from the ER. Six highly conserved cysteines are present in O-FucT-1, which is a soluble ER protein, as well as a DXD-like motif (ERD), conserved in mammals, Drosophila, and C. elegans. Both features are characteristic of several glycosyltransferase families. The membrane-bound pre-protein is released by proteolysis and, as for most glycosyltransferases, is strongly activated by manganese. O-FucT-1 is similar to family 1 glycosyltransferases (GT1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU47985.1	5.00e-228	11	400	11	400
CDZ25103.1	1.37e-14	124	400	37	339
AGI39572.1	3.64e-14	124	391	38	334
AGC68556.1	3.64e-14	124	391	38	334
ANX01433.1	3.70e-14	124	391	40	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
332	354