CAZyme Information: MGYG000001532_00257

Basic Information

• Species: Peptoniphilus_A phoceensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A phoceensis
• CAZyme ID: MGYG000001532_00257
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959	MGYG000001532_10|CGC1	108972.95	5.4425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001532	1739566	Isolate	not provided	not provided

• Gene Location: Start: 52142; End: 55021 Strand: +

Full Sequence      

MKNLGELKRNIKNLDKKDKIKIWLLILLLIFVLLISFFSALIISIISKTPATDLNNLSSS
FNQSSYIYSKDGNLIEKIESLEYRSLIDIDDIPEDIKNSFVAIEDHRFYKHKGLDPIGIM
SSIAANIKSRSLMRGGSTITQQLVRSVYLTNQKTLGRKIQEAYLSLRVEEALSKEEILEA
YLNRINLGQGSYGIEAAAQTYFSKSAVDLNIAEAALLASIPKSPANYSPFKSVPAEYLED
DFRVIGTREVDGKDLYMVLNDDAFKRQKTVLMRMHELGYIDDAQYERAKNYDIVSALNPR
NFKNHTMSSYSTDYIKKEASKYLADFYKISLDEGEHKLFTGGYKVYSTIDEEMQKDLEDK
YENFQNLLLNYSASSGSRMLGLNFDESNNIIFGDEILYFEKNNILDEKFNLVIPKSAYNI
SSHGDLKIRSSYFKDTGQKIDIIDAYNLFDDKILRTYEIGGLKIEDGAAELKNKYLIIDG
HYLKNYPDFYKIENDNLIISNKYFDYNKEPVIQPQSAMISVDNESGFVDAIIGGLDVRTK
NAKILNRATDSYRQAGSALTPFSVYLPALESGKKLSDVYDDVPMTVDGNFWPQNYYNSFK
GLMTLRLAMENSSNVIAAKVLQEIGKENAIDVLKKFDVIDENNDDYFITAKDNKKKNDEN
LESLALGNMQVGLRLSDLSKMYQTIANDGLYKEETAILKIEDPSGNIIIDNSNKNKRLFD
EKSSHLLKDVFIKNTDRGNAKNVRIGSSETAGYLGQNKTNSDYFVNAFTKSHTVSFWIGA
DSPKISLAADKSAAIDIFNKMSKNLATKENFDEDPSYIVTRSISSKSGKLATKMSDYAGA
SYKEKFISGTEPKDHDDLFKKYLICKDSNKLANQYCPSESVLYTVLFERKEGYDAKDHFG
IYPDDYMTIPKSYCNIHTREWYNENGMDDEDEDEDNNSSKKKESKKSSDKIKKTSKNKN

Enzyme Prediction     

No EC number prediction in MGYG000001532_00257.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	71	239	2.2e-61	0.9096045197740112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.42e-124	97	784	15	505	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.28e-120	41	858	26	770	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	2.38e-115	40	795	33	588	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.55e-67	97	275	26	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	1.56e-63	98	714	80	609	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT90658.1	0.0	1	930	1	929
VEJ34688.1	0.0	1	930	1	930
QQE47034.1	0.0	1	930	1	930
QAT62113.1	4.20e-206	41	928	38	943
SHD77321.1	1.37e-204	17	929	14	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	5.20e-157	50	910	6	865	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	6.75e-58	67	705	24	560	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	1.31e-50	67	784	23	699	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OQO_A	2.93e-47	81	290	17	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.46e-47	81	290	17	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0SRL7	2.44e-72	2	855	9	720	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	5.77e-71	8	809	15	673	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	8.95e-71	2	852	9	717	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
A7GHV1	4.93e-69	12	889	5	732	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A7FY32	1.57e-67	12	889	5	732	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000023	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
21	43